KEGG   Tarenaya hassleriana (spider flower): 104812215Help
Entry
104812215         CDS       T04125                                 

Definition
(RefSeq) beta-galactosidase 17
  KO
K12309  beta-galactosidase [EC:3.2.1.23]
Organism
thj  Tarenaya hassleriana (spider flower)
Pathway
thj00052  Galactose metabolism
thj00511  Other glycan degradation
thj00531  Glycosaminoglycan degradation
thj00600  Sphingolipid metabolism
thj00604  Glycosphingolipid biosynthesis - ganglio series
thj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    104812215
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    104812215
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    104812215
   00604 Glycosphingolipid biosynthesis - ganglio series
    104812215
   00511 Other glycan degradation
    104812215
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:thj04147]
    104812215
Enzymes [BR:thj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     104812215
Exosome [BR:thj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104812215
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 BetaGal_dom4_5
Motif
Other DBs
NCBI-GeneID: 104812215
NCBI-ProteinID: XP_010537559
LinkDB All DBs
Position
Unknown
AA seq 698 aa AA seqDB search
MATRRRDSPSTGRRQRNPTLLLLLLFHVAVEIYAPVSALLPSLSSSHSLSPAIQWNDKMV
LSRKFYIKDDKFWKDGNPFQIIGGDLHYFRVLPEYWEDRLMRAKALGLNTIQTYVAWNLH
EPKPGEMVFEGIADLVSFLKLCQKLDLLVMLRAGPYICGEWDLGGFPAWLLAIKPPLKLR
TSDPAYLKLVERWWAVLLPKVVPLLYHNGGPVIMVQIENEYGSYGSDKAYLHSLLALARG
HLGDDIIIYTTDGGTKETLEKGTIPLDNVYSAVDFSTGDAPWPIFELQKKFNAPGRSPPL
SSEFYTGWLTHWGEKIAKTDADFTAAALEKILSRNGSAVLYMVHGGTNFGFYSGANTDSG
ESDYKPDLTSYDYDAPIKEAGDIDNRKFQALQRVIKKYNEAPHSKKLNCKRKAYGPIQLR
RTMSLFDLANTTDPSDVINSSNPMSMESAGQMFGFLLYESSYITKKDGNILRIPKVHDRA
QVFISCLSENYNGGLRFTGTIERQNNQPVFLPTIKCASKTGLFILVENMGRVNYGPYIFD
EKGILSSVYLDGKTLHGWKMIPIPFHNLNEVPKLSFKTRFTRTSYEKFEVTSDDQKEPTV
FTGQFVIDNISEEVEEDAYLSFNGWGKGVAFVNEFNIGRYWPSFGPQCNLYVPAPILKPG
RNSVVIFELESPHPELMVQTVDQSDFTCGSDSRNVHQL
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgagaaggcgtgattctccatctacaggaagaagacagagaaatcctacactt
ctattattgctcttatttcacgtagctgtcgaaatctatgctcctgtctccgctcttctt
ccttcgctgtcctcttctcactctctgtctcctgcaattcaatggaatgataaaatggtg
ttgtctcggaagttctatatcaaagatgacaagttctggaaagatgggaacccttttcag
atcattggtggtgatttgcattactttcgggttcttcctgagtactgggaagacaggctt
atgagagccaaggcattaggtctgaacactatacaaacctatgttgcttggaatctgcat
gaaccaaagcctggagagatggttttcgagggtattgctgatctcgtgtcctttctcaag
ctgtgtcagaaacttgatttactggttatgctgcgtgctgggccttatatctgtggagag
tgggacctgggggggtttcctgcttggttactggcgataaaacccccgctcaaactgaga
acgtctgatcctgcatatcttaaattggttgaaagatggtgggctgttctgctcccaaag
gtagttcctctgctttaccacaatgggggtcctgttataatggttcagattgaaaatgaa
tatggctcatatgggagtgacaaagcttatcttcatagtttacttgctctggctagagga
caccttggagatgacataattatatataccacagatggaggcaccaaagaaactctcgag
aaaggaaccatccccctagacaacgtctattcagctgttgacttctctactggcgatgca
ccttggcctatttttgaactgcaaaagaagtttaacgctcccggaagatcacctccactt
tcctcagaattctatactggctggcttacacactggggagagaagattgcaaaaactgat
gctgattttacagcagctgccctcgaaaaaatattgtcacgaaacggttctgctgttctt
tatatggtgcatggaggaacaaactttggcttttacagtggagcaaataccgattctgga
gaatctgactacaaaccagatctgacatcctatgactatgatgctcccattaaggaagct
ggtgacatagataaccgaaaattccaggctctccagagggtaataaagaagtacaatgaa
gcaccccactccaaaaagctcaactgtaaaagaaaagcctatggaccgatccagttgcgg
aggacaatgtctctatttgatttagctaatactacagatccttcagatgtgattaattct
tctaatccaatgtctatggagtctgctggccagatgtttgggtttcttctgtatgaatct
tcatacatcacaaagaaggatggaaatatactacggatccctaaggtgcatgacagagct
caagtgtttatatcatgcctttctgaaaattacaatggaggactgagattcaccggtaca
attgagagacagaacaaccaacctgttttccttcctacaattaagtgtgcttctaagact
ggcttgttcattttggttgaaaacatgggtcgtgtaaattatggaccgtatatctttgat
gagaagggtattttgtcttctgtttatctagatggtaaaactcttcatggatggaagatg
ataccaattccttttcacaatctgaatgaagttccgaagctaagttttaagacccgtttt
accagaacgagttacgagaaattcgaggttacctctgatgatcagaaggaaccgactgta
tttactggccagtttgttatcgataatataagcgaagaagtcgaagaagacgcataccta
tcattcaacggttggggcaaaggagttgcttttgtcaatgaattcaacattggaagatac
tggccgtcatttggaccacagtgcaacctctacgttcctgctccaatccttaaacctggc
cgaaattccgtggtaattttcgagttggaatctccccatcccgagcttatggtgcaaacc
gttgatcagtccgacttcacttgcggttcggattcccgaaacgtgcatcagctgtaa

DBGET integrated database retrieval system