KEGG   Tarenaya hassleriana (spider flower): 104812715Help
Entry
104812715         CDS       T04125                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
thj  Tarenaya hassleriana (spider flower)
Pathway
thj00052  Galactose metabolism
thj00500  Starch and sucrose metabolism
thj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    104812715
   00500 Starch and sucrose metabolism
    104812715
Enzymes [BR:thj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     104812715
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 104812715
NCBI-ProteinID: XP_010538320
LinkDB All DBs
Position
Unknown
AA seq 918 aa AA seqDB search
MSSHRHCLSLSVFVIVLIFFSSLVLPSHGSAEGGETSAVGFGYSVQSVAVDSDRKILTAD
LRLIKPSSFYGPDVPSLILYASLETSERLRIRITDSEQQRWEIPETVVPRPENRSPLRFM
SENRQAPSQKGRSSAGDLLLSDPSSDLVFTLRNTTPFGFSVSRRSSGEILFDTSPAESDP
DTQLVFKDQFIQLYSALPENRSSLYGLGEHTKKSFRLVPGHTLTLWNADVGSANPDVNLY
GSHPFYIDVRGPSSSDGGDAEAEAGTTHGVLLLNSNGMDVYYGGNRITYKVIGGIIDLYL
FVGPSPEMVMRQYTEFIGRPAPMPYWSFGFHQCRYGYSNISDIESVVDGYAKAGIPLEVM
WTDIDYMDAYKDFTFDPVNFPEDRMKSFVDKLHDNGQKYVLILDPGISVNSSYGTYNRGM
EADVFIKQDGVPYLGEVWPGKVYFPDFLNPDTANFWSNEIKIFRDVLPVDGLWLDMNELS
NFITSPPTPGSSLDDPPYKIKNLGGKAQINERTVPAMSVHFGNVSEYNAHNLNGLLEAKA
THKALVDITGKRPFILTRSTFVSSGKYAAHWTGDNDAKWEDLAYSIPGILNFGLFGIPMV
GADICGFSSDTTEELCRRWIQLGAFYPFARDHSSKGTARQELYIWESVASAARKVLGLRT
RLLPHLYTLMYEAHTNGVPIARPLFFSFPKDTNTYEIDTQFLVGKSIMVSPALKPGAETV
DAYFPAGNWFDLFNYSYAVGGTSGKYVTLATPADHVNVHVREGSIVAMQGEAMTTREART
TPFQLLVVASRLENVSGEVFLDDGEDVRMGDEGGNRNWTLVRFRCKLAGKSAVLRSEVVN
GEYALNQKWIIGKVTFIGFEDVESVGGYELRTGDGSKGLRISVVKTFSDSSNPRFLGVEV
SRLSLLVGEKFQMRLKLS
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgtcatctcatcgtcactgtctctcactctcggtcttcgtcatcgtcttaattttcttc
tcgagcttggttttgccctcccatggaagcgcagaaggaggagaaacatcagccgttgga
ttcggatacagcgtccaatccgtagccgtcgattcggaccggaagattttaacggcggat
ctccgtctgattaagccgtcgtctttttacggacccgatgttcctagccttatcctctat
gccagcttggagacgagcgagcgtttgagaatcagaatcacagattccgaacaacagaga
tgggagattcccgaaaccgtcgtacctcggccggaaaaccgctcacctcttcgtttcatg
tcggagaaccgtcaagctccgtcgcagaagggtcggagctcagccggagaccttttactg
tcagatccgtcgtcggacctcgttttcaccctccgtaacaccacacccttcggcttctcc
gtctcccgacgctcctccggcgaaatcctcttcgatacgtcgccggcggaatcagatccc
gacactcaattggtattcaaggaccaattcattcaattatactccgcgttaccggaaaac
agatcgagtctgtatggactaggagaacacacgaagaaatccttcaggcttgttcctggc
cacacgttgacgctgtggaacgccgacgtcggcagcgcaaatccggatgtcaacctctac
gggtcccacccgttttacatcgacgtcagaggtccgtcctcttccgacggaggcgacgcg
gaggcagaggcggggacgacgcacggagttctgttactgaacagcaatggcatggatgtg
tattatggggggaatcggattacttataaggtgatcggcggcattatcgatctctatctg
ttcgtcggaccttcgccggagatggtgatgcgtcagtacacggagttcatcggaaggcct
gctcctatgccttactggtcttttggatttcatcaatgtcggtatggctacagcaacatt
tcagacatcgaatctgtagttgatgggtatgccaaagccggaatcccgcttgaagtcatg
tggacggacattgactacatggacgcatacaaagacttcacttttgatcctgtgaacttc
cccgaagacaggatgaagtctttcgtggacaagcttcatgacaatggccaaaaatacgtg
ctcatcttggatcccggtattagtgtgaacagctcttacgggacatataacagagggatg
gaagccgatgtgttcataaagcaagatggtgtgccttaccttggcgaagtttggcccgga
aaggtgtacttcccagatttcttgaatccagacacagccaacttctggagcaacgagatc
aaaattttccgagatgttcttcctgtggacggtctatggctggacatgaacgagttgtcc
aatttcataacttcacctccaactccgggctcttccctcgacgatccgccctacaagatt
aaaaatctcggaggcaaggcacagataaacgaaaggacagtgcctgcaatgtctgtacac
tttgggaatgttagtgaatacaatgctcataacttgaacggcctattggaggctaaggcc
actcacaaggctctggttgatataacgggcaaaaggccgttcattttgacgagatcgact
ttcgtcagctcaggaaagtacgctgctcactggacaggtgataatgacgccaagtgggag
gatctagcttattctattcctggaattctgaatttcgggcttttcggaattccaatggtt
ggagctgatatctgtggcttctctagcgataccaccgaagaattatgccgccgatggatc
cagctcggggcattttaccctttcgcgagagatcattcgtcaaagggcacggccaggcaa
gagctttatatctgggaatcagttgcttctgccgcaagaaaggtactcggcctccgtacg
aggttgctccctcacttgtacacgctgatgtacgaggctcataccaatggtgtccctatc
gcaagaccactcttcttttcgttccccaaagacacaaacacttatgagatcgatactcag
ttcctcgtcgggaaaagcatcatggtatcacctgcgttgaagccaggagccgagaccgtc
gacgcttatttccctgccggaaattggttcgacctttttaactattcttacgctgtcggt
gggacttccggtaaatacgtgactcttgctactcctgccgaccatgtcaacgttcatgtc
cgtgaaggaagcattgtggcgatgcaaggggaggcaatgacgacgagggaagccagaacg
acgccgtttcagctactggtggtggcaagccggctagagaacgtctcaggggaagtgttt
ctggacgacggagaggacgtacggatgggagacgaaggagggaacagaaactggacactg
gtgaggttccggtgcaagttggccggaaaatccgcggttctgagatcggaagtggtgaac
ggagagtacgcgttgaaccagaaatggatcatcggaaaagtaacgttcatcgggttcgag
gacgtggaaagcgtcggaggttacgaactgaggacaggcgatggatcgaaaggccttagg
atttcggtcgtgaagacgttttcggacagtagtaatccacggtttcttggcgtggaagtt
tctagactgtctttgcttgtcggagagaagttccagatgagattgaagctgagttag

DBGET integrated database retrieval system