KEGG   Tarenaya hassleriana (spider flower): 104813587Help
Entry
104813587         CDS       T04125                                 

Definition
(RefSeq) cinnamoyl-CoA reductase 1-like isoform X1
  KO
K09753  cinnamoyl-CoA reductase [EC:1.2.1.44]
Organism
thj  Tarenaya hassleriana (spider flower)
Pathway
thj00940  Phenylpropanoid biosynthesis
thj01100  Metabolic pathways
thj01110  Biosynthesis of secondary metabolites
Module
thj_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
Brite
KEGG Orthology (KO) [BR:thj00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    104813587
Enzymes [BR:thj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.44  cinnamoyl-CoA reductase
     104813587
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Epimerase NAD_binding_10 3Beta_HSD NmrA GDP_Man_Dehyd NAD_binding_4 KR Polysacc_synt_2 adh_short
Motif
Other DBs
NCBI-GeneID: 104813587
NCBI-ProteinID: XP_010539539
LinkDB All DBs
Position
Unknown
AA seq 340 aa AA seqDB search
MPVGVSPPVGKTVCVTGAGGYIASWIVKLLLERGYVVRGTVRNPDDPKNSHLRELEGAKE
RLILCRADLEDYGALKEAIEGCDGVFHTASPITDDPEKMLEPAVNGAKYVVRAAAEAKVK
RVVTTSSIAAVHVDPNRDPDAVVDENCWSDLDFCKSAKNWYRYGKTVAERAAWEEAKEKG
VDLVVLNPVLVHGPPLQPTVNASLFHILKYLTGSAKTYANSTQAYVDVRDVALAHILVFE
APSASGRYILAESALHQGEVVEILAKYFPEYPLPTNGEATMCQVLGREESEGEAVQVHEP
EDQRLGNGVHTDQAMLLRHCQELAGEGTPSTSPAIQPRRR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtcggcgtctctcctccggtcggaaaaaccgtatgcgtcaccggggccggcgga
tatatcgcctcttggatcgtcaaattgctcctggagcgaggttacgtcgtcagaggaacc
gtacgcaacccagatgatccgaagaacagccatttgagagagctcgaaggagcgaaggag
aggctgatcctgtgcagagcggatctggaggactacggtgctctcaaggaggcgatcgaa
ggctgcgatggcgtcttccacactgcttctcccatcaccgacgatcccgaaaaaatgttg
gagccggcagtgaacggagccaagtacgtcgtcagagcggctgccgaagccaaggtcaag
cgtgtggtcaccacctcctccatcgcagccgtccacgtggacccgaaccgtgaccctgat
gccgttgtggacgaaaattgttggagtgatcttgacttctgcaagagcgctaagaactgg
tatcgttatgggaagacggtggcagagcgggcggcatgggaggaggcaaaggagaaaggc
gtggacctcgtggtgctgaacccggtgctggtccacgggccaccgcttcagcccacggtt
aacgccagtctctttcatatcctcaagtacctaaccggctcagccaagacatatgccaac
tcgacccaagcttacgtggacgtccgagacgtggccttggcccacattctagtattcgag
gccccctcggcttcgggccgttacatcctggccgagagcgcgcttcaccaaggggaggtc
gttgagatactggccaagtatttccctgagtatccgcttccgaccaacggtgaagctacc
atgtgccaggtgctcggacgagaagaatccgagggcgaagccgtacaagttcacgaacca
gaagatcaaagacttgggaatggagttcacaccgatcaagcaatgcttctacgacactgt
caagagcttgcaggagaagggacaccttccacctccccagcaatccaaccaagacgccgt
taa

DBGET integrated database retrieval system