KEGG   Tarenaya hassleriana (spider flower): 104816485Help
Entry
104816485         CDS       T04125                                 

Definition
(RefSeq) histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH1
  KO
K11420  euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
thj  Tarenaya hassleriana (spider flower)
Pathway
thj00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:thj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    104816485
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:thj03036]
    104816485
Enzymes [BR:thj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     104816485
Chromosome and associated proteins [BR:thj03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     104816485
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SAD_SRA SET Pre-SET
Motif
Other DBs
NCBI-GeneID: 104816485
NCBI-ProteinID: XP_010543637
LinkDB All DBs
Position
Unknown
AA seq 688 aa AA seqDB search
MEGFSGNQHDKTRVFDVKPLRSLMPIFPDAKQGPPFVCAPPFGPFPSGFSPFYPFSSPQA
QPQEQAQPQAQSREQAQPQAQTQEQAHAYQHTPDLNQSQRGQASFVTPLRTFRTDDLPNG
HSEHEESNSLKRKSRKTKKTPTQFGSGEGAAVSGGGFVSGISVPDRENGNRELVINVLLR
FDALRRRFAQLEDAKEAVSGVIKRADLKAGSSCMSKGVRTNMTKRLGIVPGVEIGDIFFF
RFEMCLVGLHSPSMAGIDYMVIKDDADEDPVATSIVSSGYYDNDEANSDILIYSGHGGNA
DRDKQASDQKLERGNLALERSLRRFSPVRVIRGFKDASKNGSPKIYIYDGLYEIKESWVE
KGKSGHNTFKYKLVRIPGQPPAFAVWKSVQKWKEGFPSREGLILPDLTSGAESIPVSLVN
DIDTEKGPAYFTYSPTVKYSEQFRLVHPSSGCDCHPACKPGNLNCSCIRKNDGDFPYTGN
GILVSRKPVIYECSPACPCMNCKNRVTQMGLKVRLEVFKTANKGWGLRSWDPIRAGSFIC
IYAGEAKNKSMLQGAVADDDYTFDTTRAYTPFKWNYEPGLAEEDNSEEISEDFYIPAPLV
ISAKNVGNVARFMNHSCSPNVFWQPVMYEHNNQSFFHVAFFALSHIPPMTELTYDYGVSR
PSGTEAGAPLYGKKKCLCGSEYCRGSFG
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atggaagggttttcaggtaaccagcatgataaaacgagagtcttcgatgtgaaaccactt
cgttctctaatgccgattttccctgatgccaaacaaggtccaccctttgtgtgtgcacct
ccctttggaccttttccatctgggttctcaccgttttatccatttagctcacctcaagca
cagccacaagaacaagcccagccacaggcacagtcacgagaacaagcacaaccacaggca
cagacacaagaacaagcacatgcataccaacacaccccagatctgaatcaatcccaaagg
ggtcaagcttcatttgtcactccccttaggacctttagaacagacgatttgcctaatggc
cactcagagcacgaggaatccaattccttaaaaaggaagagtagaaagaccaagaaaact
ccgactcaatttggttctggcgagggtgctgcagtgtctggtggaggttttgtcagtggg
attagcgtaccagaccgggagaatggtaatagggagttggtgatcaatgtgcttttgcga
tttgatgcgctcagaaggagatttgcccaactggaggacgcaaaggaagcagtcagtggt
gttatcaaacgtgctgatctgaaagctggatcttcttgcatgagcaaaggtgtgcgaaca
aacatgacaaaaaggcttggaattgttcctggggttgagattggggacatattcttcttt
aggtttgagatgtgtttggtgggattacattctccatcgatggctggcatcgactatatg
gttatcaaggatgacgcagatgaagatcctgttgctactagcattgtttcatctggatat
tatgataatgatgaagctaattctgatattttaatttatagtggccacggtgggaatgct
gacagagataagcaagcatctgaccaaaagcttgaacggggtaatcttgctctggagagg
agtttgcggcggtttagccctgtaagagtcatacgtggctttaaagatgcctccaagaat
ggcagtcctaagatctatatttatgatggcctgtacgaaatcaaagagtcatgggtagag
aaagggaaatctgggcacaatactttcaagtataaattggtgagaattcctggccagcct
cctgcctttgctgtctggaaatcagtccagaagtggaaggaaggttttccctcaagggag
ggccttattcttcctgatctcacttctggggctgaaagcatacctgtttcgctcgtgaat
gacattgacactgaaaagggccctgcttatttcacctactctccaacagtaaagtactcg
gaacagttcagactagttcacccttcctctggatgtgactgtcacccagcatgcaaaccc
ggaaacctaaactgttcctgcatccggaaaaatgacggtgatttcccttacacgggtaat
gggattctagtttctcggaagccggtgatatatgaatgcagcccagcatgcccatgtatg
aattgcaaaaacagggtaacccaaatgggattgaaagttcggttggaagttttcaagaca
gcgaataagggttggggcttacggtcatgggatcctatccgagctggttcttttatatgt
atatatgcaggagaagccaaaaacaagtccatgttgcaaggagctgtggctgatgatgat
tacacctttgatacaacccgggcttatacaccctttaagtggaactacgaaccgggcttg
gcagaggaggataattctgaggagatatctgaagatttctatataccagcaccacttgta
atcagtgcaaagaatgttggaaatgtggctcggttcatgaaccacagttgctctccaaat
gtcttctggcagccggttatgtatgagcataacaatcaatccttcttccatgtcgccttt
tttgccctttcgcacatccctcccatgaccgaactaacatacgattatggagtttctcgt
ccaagtggaacagaggcaggtgctcctctgtatgggaagaagaaatgtttgtgtggatca
gagtactgccggggatcattcggttga

DBGET integrated database retrieval system