KEGG   Tarenaya hassleriana (spider flower): 104816650Help
Entry
104816650         CDS       T04125                                 

Definition
(RefSeq) transcription factor bHLH140
  KO
K10863  aprataxin [EC:3.1.11.7 3.1.11.8 3.1.12.2]
Organism
thj  Tarenaya hassleriana (spider flower)
Brite
KEGG Orthology (KO) [BR:thj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:thj03400]
    104816650
Enzymes [BR:thj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.7  adenosine-5'-diphospho-5'-[DNA] diphosphatase
     104816650
    3.1.11.8  guanosine-5'-diphospho-5'-[DNA] diphosphatase
     104816650
   3.1.12  Exodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.12.2  DNA-3'-diphospho-5'-guanosine diphosphatase
     104816650
DNA repair and recombination proteins [BR:thj03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     104816650
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Other NHEJ factors
     104816650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DcpS_C AAA_33 HIT Macro zf-C2HE Zeta_toxin AAA_18 AAA AAA_16 AAA_29 AAA_17 CPT AAA_22 ABC_tran FtsK_SpoIIIE
Motif
Other DBs
NCBI-GeneID: 104816650
NCBI-ProteinID: XP_019058413
LinkDB All DBs
Position
Unknown
AA seq 709 aa AA seqDB search
MDMEIDDSPEGEKTEPTVVMLVGAPGSGKSTFCDTVMRSSRRPWVRVCQDTINNGKAGTK
AQCLKMAINALKESNSIFIDRCNLDRDQRSEFVKLGGAEVEVHAVVLDLPAQVCISRSVK
RTGHEGNLQGGRAAAVVNRMLQSKELPKLSEGFSRITFCYSDKDVENAVSSYSLLGPKDT
LPSGCFGQKNTNAKSQLGIMKFFKKVNALPGPASKEASTSQESNEKTAKKEENLSLIPSA
QLTSTDIIPTLAFPSISTADFQFDLEKAADIIVEKVEEFLPMLGNARVVLVDLSHGSKIL
SLVKTKASQKNIDSARFFTFVGDITKLRSEGGLQCSAIANAANWRLKPGGGGVNASIFMA
AGSDLEAATRQRANSLLPGKAVVVALPSTCPLVCAEGITHVIHVLGPNMNPKRPNYLNND
YTNGCKILREAYTSLFEGFLSIIKNQSKLPKRRNETTRSGSGGEEIKEDPERNKKCKGLQ
DVVIADESNTGAVGHVRDGGKSKSKGWGSWALALYNIAMQPDRHENIVLEVLDDIVVIND
QYPKARKHLLIIARQEGLDRFADAQREHLQLLQKMHDVGSKWVKRFWDDDPSLVFRLGYH
SVPSMRQLHLHVISQDFDSDHLKNKKHWNSFTSSFFRDSVDVMEEINVQGMATVASEDVL
TAELRCHRCKSAHPSIPKLKSHIRSCRAPFPDHFLQNNRLLTHPDSETD
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atggacatggaaatcgacgactcccctgaaggagagaagacggagccgacagtggtaatg
ctggttggtgcaccgggaagcgggaaatccacgttttgcgacactgtcatgcgctcctct
cgccgcccatgggttcgcgtttgccaggacaccattaacaatggtaaagctggaacaaag
gctcagtgcctaaagatggcaatcaacgccctgaaggaaagcaacagtatctttatagac
agatgcaaccttgacagggatcagcgctcggagtttgttaagctcggaggcgccgaggtc
gaagtccatgcagtggtgcttgatctccctgctcaggtttgtatatctcgatcggtcaaa
cgaaccgggcatgaaggaaatctacaagggggaagagctgcagctgttgtaaataggatg
cttcagagtaaggagcttccaaaattgagtgaagggttttctcggatcacgttttgttac
agtgataaagatgtcgagaatgctgttagctcttacagcttgctcggtccaaaggatact
cttccatcgggctgcttcggccaaaagaacacaaatgccaaaagtcaacttggtataatg
aagttctttaagaaagtcaatgctttgccaggaccagcttctaaagaagctagcacatct
caagaatctaatgaaaagacagcaaagaaagaagaaaatctgtccctgattccttcggct
cagcttacttctaccgatattattcccacgttggcattcccgtcaatctcaacggcagat
tttcagttcgaccttgagaaggcagctgatataattgttgagaaagtggaggaattcctg
cctatgctcggaaatgcacgggttgtcttggtggacctgagccatggatcaaagattttg
tctttggtcaagacaaaggcttctcagaagaacattgactcagcaaggtttttcacattt
gttggggatataactaaacttcgttctgaaggtggtctgcagtgcagtgccatagctaat
gctgctaactggcggcttaaacccgggggtggaggagtaaatgcatcgattttcatggct
gctgggtcagatcttgaggctgcaacgagacaacgagcgaattctcttcttccgggaaag
gccgtagttgttgctctcccttctacctgccctttagtctgtgcggaagggataacacat
gtgatacatgttctgggaccaaacatgaatccgaagcgaccaaattaccttaacaatgac
tataccaacggctgcaagattctgcgagaggcttacacatctctctttgaagggtttctg
tctattataaagaatcaatcaaaattacccaaaagaaggaatgagactactagatcaggt
tctggtggtgaggagattaaggaggatcctgagagaaataaaaagtgcaaggggctccaa
gatgtagtcatagccgatgaatcgaacactggggcagttgggcatgtgagagacggtgga
aagagcaagagtaagggttggggctcatgggcattggctctgtacaatattgccatgcaa
ccggatagacacgagaatattgtgctagaggtattggatgacattgttgtgataaacgac
cagtatccaaaggcaaggaagcacttgctaataattgcaagacaggaaggtctagaccgg
tttgccgatgcccagagagagcatcttcaactgctgcagaaaatgcacgacgtgggatcg
aaatgggtgaagagattctgggatgatgacccctctctggtcttccggttgggttaccac
tcggttccatcaatgcgacaacttcacctacatgttatcagccaagacttcgattccgac
cacttgaagaacaagaaacattggaactccttcacctcctcattcttccgagactcggtc
gatgtaatggaggagatcaatgtccagggcatggccactgtggcaagtgaagatgtttta
actgcggagttgcgttgtcaccgttgtaaaagtgctcacccgagtattccgaagctgaaa
tcgcacataagaagctgccgagctccattccccgaccattttctccaaaacaatcgtctt
ttgacccatcccgactcggagaccgattaa

DBGET integrated database retrieval system