KEGG   Tarenaya hassleriana (spider flower): 104818230Help
Entry
104818230         CDS       T04125                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B4, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
thj  Tarenaya hassleriana (spider flower)
Pathway
thj00010  Glycolysis / Gluconeogenesis
thj00053  Ascorbate and aldarate metabolism
thj00071  Fatty acid degradation
thj00280  Valine, leucine and isoleucine degradation
thj00310  Lysine degradation
thj00330  Arginine and proline metabolism
thj00340  Histidine metabolism
thj00380  Tryptophan metabolism
thj00410  beta-Alanine metabolism
thj00561  Glycerolipid metabolism
thj00620  Pyruvate metabolism
thj01100  Metabolic pathways
thj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:thj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104818230
   00053 Ascorbate and aldarate metabolism
    104818230
   00620 Pyruvate metabolism
    104818230
  Lipid metabolism
   00071 Fatty acid degradation
    104818230
   00561 Glycerolipid metabolism
    104818230
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    104818230
   00310 Lysine degradation
    104818230
   00330 Arginine and proline metabolism
    104818230
   00340 Histidine metabolism
    104818230
   00380 Tryptophan metabolism
    104818230
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    104818230
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    104818230
Enzymes [BR:thj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     104818230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 104818230
NCBI-ProteinID: XP_010546022
LinkDB All DBs
Position
Unknown
AA seq 539 aa AA seqDB search
MAARRFSPLFFRSLSAPSSSFLTRSSGKNGFSGRNSKGFATTAAAVEEIINPPVQVSYTQ
HLINGNFVDSASGKTFPTLDPRTGEVIAHVAEGDAEDIDRAVKAARKAFDEGPWPKMPAY
ERSRILLRFADLVEKNSEELAILETWDNGKPYEQSSKSEIPMLARLFRYYAGWADKIHGL
TVPADGNYHVQTLHEPIGVAGQIIPWNFPLLMFAWKVGPALACGNTLVLKTAEQTPLTAL
YAGKLFHEAGLPDGVLNIVSGYGPEAGAPLASHMDVDKLAFTGSTETGKVVLELAAKSNL
KPVTLELGGKSPFIVCEDADIDKAVELAHFALFFNQGQCCCAGSRTYVHERVYDEFVEKA
KARALRRAVGDPFKKGIEQGPQVDSEQFEKVMRYIRSGLESDAVLECGGERIGNKGYFIQ
PTVFSNVKEDMLIARDEIFGPVQSILKFKDLDEVIQRANNTRYGLAAGVFTRSLETANRM
TRALRAGTVWVNCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVAPLKNPAWI
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggcggctcgcagattctcccctctcttctttcggtctctctctgctccttcttcctct
tttctgacccgttcttcagggaaaaatggcttcagtggaagaaacagcaaagggttcgcg
acaacagctgcagctgttgaggaaatcatcaatcccccggttcaagtttcttacacccag
catctcatcaatggaaacttcgtcgattcagcttccggtaagacgttcccgactcttgac
ccgcgaacgggtgaagtcattgctcatgtggctgaaggcgatgccgaggacattgatcgg
gcagtgaaggctgctaggaaggcctttgatgaagggccttggccaaaaatgccggcttat
gaaaggtcgagaatattgctgagattcgccgacttggtcgagaaaaacagtgaagagctt
gcgattctggagacgtgggacaatgggaagccttatgagcaatcctcaaaatctgaaatt
ccgatgcttgccagattgttccgctactatgctggttgggcggacaagattcacggcttg
acagttccagctgatggaaactatcatgtccagacgttacacgagccaattggtgtggct
ggacaaattatcccgtggaactttccgcttctaatgtttgcttggaaagttggcccggct
cttgcttgcggtaacacccttgtcctcaaaaccgcagaacagacacctcttaccgctttg
tatgctggaaagctttttcatgaggcgggtcttcctgatggtgttctgaatatagtttct
gggtatggtccggaggcgggtgctcccctagccagtcacatggatgtagacaagcttgct
ttcaccgggtcaactgaaacaggcaaggtggttcttgaattagccgcgaagagcaatctc
aagccggtaacccttgaactcggaggaaaatcaccgttcattgtatgcgaggacgctgat
atcgataaagctgtggagcttgcacactttgccctgttctttaaccaggggcaatgctgc
tgtgccgggtcacgcacgtatgtccatgaacgagtttacgatgaatttgtagagaaagct
aaagcacgagcattgagacgtgctgttggtgatccctttaagaaaggcatcgaacaaggc
ccccaggtggactcagagcaattcgagaaggtgatgaggtacataagatcggggctcgaa
agcgatgccgttcttgaatgcggcggtgaaaggatcggtaacaaaggatacttcatccag
ccaacagtcttctccaatgttaaggaagacatgcttatcgctcgagatgagatcttcggt
ccagtccaatcgattctgaaattcaaggacttggacgaggtgatacagagggcgaacaac
acaaggtacgggcttgcggccggggttttcacgaggagcctcgagacagcgaaccggatg
acgagggcgctgagggctgggacggtgtgggtgaactgctttgacgttttcgacgcggcc
attccattcggtggatacaagatgagtggcattggtcgagaaaagggtatatacagtctc
cacaattacttgcaggtcaaggcagttgttgctcccctcaagaatcctgcttggatttga

DBGET integrated database retrieval system