KEGG   Tarenaya hassleriana (spider flower): 104819221Help
Entry
104819221         CDS       T04125                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
thj  Tarenaya hassleriana (spider flower)
Pathway
thj00020  Citrate cycle (TCA cycle)
thj00190  Oxidative phosphorylation
thj01100  Metabolic pathways
thj01110  Biosynthesis of secondary metabolites
thj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:thj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    104819221
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    104819221
Enzymes [BR:thj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     104819221
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 FAD_binding_3 GIDA DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 104819221
NCBI-ProteinID: XP_010547500
LinkDB All DBs
Position
Unknown
AA seq 633 aa AA seqDB search
MWRCVSRGLRVPSSRTSFFNDHSGSRFSRFFSTGSTEGRSSYTIVDHTYDAVVVGAGGAG
LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL
GDQDAIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCACAA
DRTGHALLHTLYGQAMKHNTQFFVEYFALDLLMNSDGSCHGVIALNMEDGTLHRFRAAQT
ILATGGYGRTYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGSR
GEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLP
PEVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIEGNDPDAV
IPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIQKPGEKQKPLEKDAGEK
TIAWLDKIRNSNGSLPTSEIRLNMQRVMQNNAAVFRTQETLEEGCHLIDQSWESYGDVRV
KDRSLIWNSDLIETVELENLLINACITMHSAEARKESRGAHAREDFTKRDDENWMKHTLG
YWEEGKVRLDYRPVHMNTLDNEVETFPPKARVY
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgctgcgtttctcgtggccttcgtgttccttcttcgaggacatcgttcttcaat
gaccattctggatctcggttttccagattcttttccaccggttcgaccgaggggagatcc
tcgtacacgattgtggatcatacatatgatgcggtcgtcgtcggagctggtggtgctggt
cttagggcggcgattggattgtcggagcatggatttaacaccgcttgcattaccaagctt
tttccgactcgttcacacaccgtcgctgcccagggtggcataaacgctgcattgggaaat
atgacagaagatgactggcggtggcacatgtatgacactgtgaaaggaagtgactggcta
ggtgaccaagatgccatccagtatatgtgtagagaggcaccaaaagcagttattgagctt
gagaattatgggctgccattttctaggactgaagacggtaaaatttatcagcgtgcattt
ggtggtcagagtcttgactttggaaaaggtggtcaggcgtatcgttgcgcatgtgctgcg
gataggactgggcatgctcttttgcatactctctatggccaagctatgaagcataacacc
cagttttttgttgaatatttcgctttggatttactgatgaatagtgatggcagctgccac
ggtgtaatcgcgctgaacatggaggatggaacattgcatcggttccgtgctgcacagaca
attttggccactgggggctatggtagaacatacttttctgcaacctcggcgcacacatgc
accggagatggcaatgccatggttgcacgtgctggacttcctctccaggatttagagttt
gttcaattccatccaacgggcatttatggagcgggatgtctcatcactgaagggtctcga
ggcgagggcggtattcttagaaatagtgaaggtgaacgttttatggaacgatatgctcct
actgccaaggatcttgcttcgagagatgttgtctccagatctatgacaatggaaattagg
gaaggtcgtggcgtaggaccgctaaaggatcacatctatcttcatttgaaccatcttcca
ccagaagtcctaaaagaaagacttcctggtatctctgagactgctgccatctttgccggt
gttgatgttaccaaagaaccaattcctgtcttgccgaccgtacattacaacatgggtggt
atccctacaaatcaccacggtgaggtggttaccattgaaggcaatgatccagatgccgtg
attccaggactaatggctgctggggaggcagcctgcgcttctgttcatggagctaatcgg
cttggtgcaaattcactgctcgacattgttgtctttggccgtgcttgtgcaaatagggtt
gcagagatacagaagccaggggagaaacagaaacctcttgagaaggatgcgggtgagaaa
actatcgcatggctggacaaaataaggaactccaacgggtcgcttcctacttctgagatc
cgattgaacatgcagcgagtgatgcagaacaatgcagctgtcttccgaacacaagagact
ctagaagaaggttgtcacttgatcgaccaatcatgggagagctatggtgatgttcgggtg
aaggatcggagtttgatatggaactctgatttgatcgagactgtagagttggaaaacctt
ctgataaacgcatgcatcaccatgcattctgctgaagcccgaaaagagagcagaggagca
catgctcgggaagatttcacgaaaagagatgatgagaactggatgaagcatacattgggg
tactgggaagaaggaaaggtccggctggactacaggccagttcacatgaacactcttgac
aacgaagtcgagactttcccgccaaaagctcgtgtctactga

DBGET integrated database retrieval system