KEGG   Tarenaya hassleriana (spider flower): 104821278Help
Entry
104821278         CDS       T04125                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
thj  Tarenaya hassleriana (spider flower)
Pathway
thj00020  Citrate cycle (TCA cycle)
thj00190  Oxidative phosphorylation
thj01100  Metabolic pathways
thj01110  Biosynthesis of secondary metabolites
thj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:thj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    104821278
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    104821278
Enzymes [BR:thj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     104821278
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 DAO FAD_binding_3 GIDA HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 104821278
NCBI-ProteinID: XP_010550391
LinkDB All DBs
Position
Unknown
AA seq 634 aa AA seqDB search
MWRCVSRGLRVASSSRTSLFDGHSGSRFSRFFSTGSTGGRSSYTIVDHTYDAVVVGAGGA
GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALANMTEDDWRWHMYDTVKGSDW
LGDQDAIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCACA
ADRTGHALLHTLYGQAMKHNTQFFVEYFALDLLMNSDGSCQGVIALNMEDGTLHRFRAAQ
TILATGGYGRTYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGS
RGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHL
PPEVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTVKGNDPDA
VIPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEICKPGGKQRPLEKDAGE
KTIEWLDKIRNSNGSLPTSQIRLNMQRVMQNNAAVFRTQETLEEGCDLIDRAWDSYGDVK
VKDRSLIWNSDLIETVELENLLINACITMHSAEARKESRGAHAREDFTKRDDENWMKHTL
GYWEEGKVRLEYRPVHMNTLDDEVETFPPKARVY
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgctgcgtttctcgtggccttcgtgttgcttcttcttcgaggacatcgctcttc
gatggccactctggatctcggttttccagattcttctccactggttcgaccggtgggaga
tcctcttacacgattgtggatcatacatatgatgcggtcgtggtcggagctggtggtgct
ggacttagggcggcgattggattgtcggagcatgggtttaataccgcttgcattaccaag
ctgtttccaacccgttcacacaccgtcgctgctcagggtggtataaatgctgcgttggca
aatatgacagaagatgactggcggtggcacatgtacgacactgtgaaaggaagtgactgg
ctaggtgaccaagatgccatccagtatatgtgcagagaggcaccaaaagcagttattgaa
cttgagaattatgggctgccattctctagaactgaagatggtaaaatttatcagcgtgca
tttggcggtcagagtcttgactttggaaaaggtggtcaggcttatcgttgcgcatgtgct
gcggataggactgggcatgctcttttgcatactctctatggccaagctatgaagcataac
acacagttctttgttgaatactttgctttggatttacttatgaacagtgatggcagttgc
cagggtgtaatcgcactgaacatggaagatggaacattgcatcggttccgagctgcacaa
acaattttggccactgggggctatggtagaacatacttttctgcaacctcggcacacaca
tgcacaggagacggcaatgctatggttgcacgtgctggacttcccctccaggatttggag
tttgttcaattccatccaacgggtatatatggagctggatgtctcatcactgaagggtct
cgaggtgaaggtggtatccttagaaatagtgaaggtgaacgttttatggaacgatatgct
cctacagctaaggatcttgcatcaagagatgttgtctctagatctatgacgatggaaatt
agggaaggtcgaggtgtaggacctctgaaggatcacatctatcttcatttgaatcatctt
ccaccggaggttctaaaagaaagacttcccggtatctctgagacagctgccatctttgct
ggtgttgatgttaccaaggaaccaattccagtcttgccgacagtacactacaacatgggt
ggtatccctacgaatcaccatggtgaggtagtaacggttaaaggcaatgatccagatgcg
gtgattcctgggctaatggctgcaggggaggcagcatgtgcatctgttcatggggctaac
cggctaggtgcaaattcactgcttgacattgttgtctttggccgcgcgtgtgctaatagg
gttgcagaaatatgcaagccaggtgggaaacagagaccactggagaaagacgcgggagag
aaaactattgaatggttggacaaaataaggaactcgaacggctcgcttcctacttcgcag
atccggctgaacatgcaaagagtaatgcagaacaatgctgctgtcttccgtacccaagag
acactggaagaaggttgtgacttgatcgaccgtgcctgggatagctacggtgatgtaaag
gtcaaggatcggagtttgatatggaactctgatttgatagagacagtagagttggaaaac
cttctgataaatgcgtgcatcaccatgcattccgctgaagcacgaaaagaaagcagagga
gcccatgctcgcgaagatttcacgaaaagagatgatgagaactggatgaagcatacattg
ggatactgggaagaagggaaggtgcggctggagtacaggccggttcacatgaacactctt
gacgacgaagtcgagaccttccctcccaaggctcgggtctactga

DBGET integrated database retrieval system