KEGG   Tarenaya hassleriana (spider flower): 104822100Help
Entry
104822100         CDS       T04125                                 

Definition
(RefSeq) alpha-amylase 3, chloroplastic
Organism
thj  Tarenaya hassleriana (spider flower)
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amyl_C2 Alpha-amylase CBM53
Motif
Other DBs
NCBI-GeneID: 104822100
NCBI-ProteinID: XP_010551510
LinkDB All DBs
Position
Unknown
AA seq 913 aa AA seqDB search
MSTITIEPFLHHCCRRQSPRISRGARDFRPCSLSLRGCFTSKTLLSNGRSIAAGAGARDR
AGAFTSFGLRSLKRWRFVTIQASSTDAAVMETSDDVVFKETFPIKRIEKVEGKIYVRLTQ
VKGNNWQLSVGCNLAGKWIIHWGVSYAGDIGSEWDQPPEDMRPPGSVAIKDYAIETPLKK
SSEGDPFHEVKIDLNLKSSIAALNFVLKDEETGVWYQHRGRDFKVPLLDYVDDDGNVIGA
KRGFGIWPGALGQLSSILLKSDELHTKDQDSSKESAGFGQEKKGLEGFYEEILITKEVAV
VNSVSVIVKKCPKTSKNMVHLETDTPGDVIVHWGVNKAGSRNWEIPAEPYPEETSLFKNK
ALRTRLRPKDDGSGSYGFFHLDEKLAGLSFVLKLNENTWLNDKGDDFYVPFITSSSLPVE
TEAAQVSRTTTEVDQEGSQSAYTKEIINEIRNLVSDISSQKNQKTKTKEAQENILQEIEK
LAAEAYSIFRSTVPTFTEESISEVKAEKPQVKISSGTGTGYEILCQGFNWESHKSGRWYM
ELKDKADEIASLGFTIVWLPPPTESVSPEGYMPKDLYNLNSRYGTIDELKDLVTRYHEVG
IKVLGDVVLNHRCAHYKNGNGIWNLFGGRLNWDDRAIVADDTHFQGRGNKSSGDNFHAAP
NIDHSQEFVRKDLKEWLNWLREEVGYDGWRLDFVRGFWGGYVKDYLESSEPYFAVGEYWD
SLSYTYGEMDYNQDAHRQRIVDWINATNGTAGAFDVTTKGILHAALDRCEYWRLSDASGK
PPGVVGWWPSRAVTFIENHDTGSTQGHWRFPGGKEMQGYAYILTHPGTPAVFFDHIFSNY
RSEIAHLISLRNRNQINCRSTVKITKAERDVYAAIIDEKVAMKIGPGHYEPPSGPQNWTH
SIQGKDFNVWELS
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atgtctacaatcaccatagagccttttctacaccattgttgtcgtcgacagagccctaga
atctctcgtggagcccgggattttcggccatgctcgctgagtctgcgtggttgtttcact
tcgaagacgctcctctctaatggaagaagcatcgccgccggtgcaggagccagagacaga
gccggagccttcacgagctttggtctccgtagcttgaagcgttggaggttcgtgacgatc
caagctagctcaaccgatgctgctgtcatggaaacttcggatgatgtcgtcttcaaggaa
actttcccaatcaagcgaattgagaaggtggaaggaaagatttatgttagattgactcag
gtgaagggaaacaattggcagctcagtgtaggatgtaatcttgctggaaaatggatcatt
cattggggagtttcatatgcgggtgatatcggcagcgaatgggaccaacctccggaagat
atgagaccgcccggttctgttgctatcaaggactatgccatcgagacacccttgaagaag
tcatcagaaggagatccatttcatgaagtcaaaatcgatctgaatctcaaaagctcaata
gcagctcttaattttgtgttgaaggatgaagagactggagtttggtatcagcacagagga
agagattttaaggttcctcttctggactatgttgatgacgacggcaatgtgattggagca
aagagaggcttcggtatatggccaggcgcccttgggcagctctcaagcatccttctcaaa
tcagatgaactgcatactaaagatcaagatagcagcaaggaatcagctggttttggacaa
gaaaagaaaggcctcgaagggttttatgaggagatccttattactaaagaagttgcagtt
gttaactcagtcagtgtcattgtgaaaaaatgccccaagacatctaaaaatatggtacat
ttggaaactgatacacccggtgatgttattgtccattggggagttaacaaagctggcagt
agaaactgggaaattccagctgaaccatacccagaagagacatctttgtttaagaacaaa
gcattaaggactcgcttacggccaaaggatgatggaagtggatcttatggatttttccat
ttggatgagaagctcgcagggttatcttttgttctcaagttaaatgaaaatacttggctg
aatgataagggcgatgacttctatgtccctttcattacttcaagtagtttgcctgttgaa
actgaagctgctcaagtgagtagaaccacaacagaagttgatcaagaaggttcccagagc
gcttacactaaggaaatcatcaatgaaataaggaacttggtgagtgacatctcctcacaa
aagaatcagaagacaaagacaaaagaagcacaagagaacattctgcaagagattgagaaa
ctagctgctgaggcatacagtatatttagaagcactgttccaacatttacagaggagagt
atttcagaagtaaaggctgagaagcctcaggtcaaaatatcctctggaacaggcacagga
tatgagatattgtgccaaggatttaactgggagtcccacaaatcgggaagatggtacatg
gaattgaaagataaagccgatgagatagcttcacttggatttaccattgtgtggttacct
cctccaacagaatctgtgtcacctgaaggatacatgcctaaagacctgtataatttgaac
tcaagatatggaactattgatgagctgaaagatctcgtgacgagatatcacgaggttggg
atcaaagttcttggtgatgttgtcttgaatcatcgatgtgcgcattacaagaatggaaat
ggcatttggaatctattcggtgggcgtctgaattgggatgatagggcaatagttgcagat
gacactcactttcagggtaggggaaacaagagcagtggtgataatttccacgctgctcca
aacatagatcactcacaggagtttgttaggaaggacctcaaggaatggttaaactggctc
agagaagaagtagggtatgatgggtggaggcttgattttgtaagaggattttggggaggt
tatgtgaaggactatttggagtcaagtgagccatactttgctgtaggtgaatattgggat
tctcttagttacacgtacggagaaatggactacaatcaagacgctcatcgacagaggatt
gtcgactggattaacgccaccaatggaactgcaggcgctttcgatgtcacaaccaaaggg
attcttcacgctgcacttgacagatgtgaatattggaggctctcggatgcgagtggaaag
cctccaggggtggttggatggtggccttctcgtgctgtaacgttcattgagaatcacgac
actggttctacacagggtcattggagatttccaggtgggaaggaaatgcagggatacgca
tacatattgacgcatccgggaacaccggcagtgttcttcgaccatatcttctctaactac
cgttccgaaattgcccatcttatctctctcagaaaccgcaaccaaatcaactgtcggagc
actgtgaaaataacaaaggcggagagggatgtatacgcggccataatagacgagaaggtg
gcgatgaagatcgggcctggtcattacgaaccaccaagtggccctcaaaactggactcat
tccatccaaggaaaagacttcaacgtctgggaattgtcgtaa

DBGET integrated database retrieval system