KEGG   Tarenaya hassleriana (spider flower): 104822963Help
Entry
104822963         CDS       T04125                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B7, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
thj  Tarenaya hassleriana (spider flower)
Pathway
thj00010  Glycolysis / Gluconeogenesis
thj00053  Ascorbate and aldarate metabolism
thj00071  Fatty acid degradation
thj00280  Valine, leucine and isoleucine degradation
thj00310  Lysine degradation
thj00330  Arginine and proline metabolism
thj00340  Histidine metabolism
thj00380  Tryptophan metabolism
thj00410  beta-Alanine metabolism
thj00561  Glycerolipid metabolism
thj00620  Pyruvate metabolism
thj00903  Limonene and pinene degradation
thj01100  Metabolic pathways
thj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:thj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104822963
   00053 Ascorbate and aldarate metabolism
    104822963
   00620 Pyruvate metabolism
    104822963
  09103 Lipid metabolism
   00071 Fatty acid degradation
    104822963
   00561 Glycerolipid metabolism
    104822963
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    104822963
   00310 Lysine degradation
    104822963
   00330 Arginine and proline metabolism
    104822963
   00340 Histidine metabolism
    104822963
   00380 Tryptophan metabolism
    104822963
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    104822963
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    104822963
Enzymes [BR:thj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     104822963
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 104822963
NCBI-ProteinID: XP_010552639
LinkDB All DBs
Position
Unknown
AA seq 533 aa AA seqDB search
MASRRISSLLSRSVASSSSSLLLRGKIPHISRYSTAAAALGEPIPPPVKVEYTHLLIDGK
FVDAASGKTFTTLDPRTGEVISHVAEGDSEDVNRAVSAARKAFDEGPWPRMTAYERSKIL
LRFADLIEKHNDEIAALETWDNGKPYEQSAKIEVPMLARLFRYYAGWADKIHGLTVPADG
PHHVQTLHEPIGVAGQIIPWNFPLLMLAWKLGPALACGNTVVLKTAEQTPLSALYAGKLL
HEAGLPPGVVNIISGFGPTAGAAIASHMDIDKVAFTGSTETGKVVLELAAKSNLKQVTLE
LGGKSPFIVCEDADVDKAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARAIK
RAVGDPFKAGIEQGPQVDSEQFQKILKYIRSGIESGATLQAGGDQLGSKGYYIQPTVFSD
VKDEMLIANDEIFGPVQSILKFKDLDEAIRRANKSRYGLAAGVFTQNLDTANRLMRALRV
GSVWINCFDVFDASVPFGGYKMSGFGREKGIYSLNNYLQVKAVVTPLTNPAWL
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgaggaggatttcttctctgctctctcgctctgtagcttcttcgtcttcttcg
cttcttctcagagggaagatcccacacataagcagatacagcacagctgctgctgctctc
ggggagccgattcctccaccggtgaaggttgagtacacccacctcctaatcgatggaaaa
ttcgtcgatgcagcctctggnaaaactttcactacattggacccgagaacaggggaagtg
atctctcatgtggccgagggtgactctgaggacgtgaaccgagcggtttcggctgctcgt
aaggcctttgatgagggaccgtggcctagaatgactgcttatgaaaggtccaagatctta
ctgcgttttgctgatttgatcgaaaaacacaacgatgagatcgcagcactcgagacatgg
gataacggaaaaccttacgaacaatctgccaagatcgaagtgccaatgctcgcacgtctt
ttccgatactatgccggttgggcagacaagatccatggtctgacggttccagctgatggt
ccgcaccatgtgcagactctccacgaaccaataggggtcgctggtcagatcatcccttgg
aattttcctcttctaatgctcgcatggaaactaggacctgcattagcatgtggaaacacc
gttgtcctcaagacagccgagcagactcctctgtctgctctctacgcagggaaacttctt
catgaggctggacttccccctggtgttgtaaatataatttctggatttggtccgacggct
ggtgcagccatcgctagtcacatggatatcgataaggtagcttttacgggttctaccgaa
acgggaaaggttgttcttgagttggctgccaaaagcaatcttaagcaagtgactctggag
ctggggggaaagtcgccattcatcgtatgtgaagatgctgatgtagataaggctgttgag
cttgcccacttcgctctgttctttaaccagggacaatgctgctgtgccggctcacgcacg
ttcgtacatgagcgtgtgtatgatgaattcgtagagaaagcaaaagctcgggctatcaaa
cgtgctgtcggcgatcctttcaaggcgggcatcgagcaaggtcctcaggtggactcagaa
cagtttcagaagatattgaagtacataagatcaggcattgagagtggagccactctccaa
gctggaggagaccaacttggttccaagggatactatatccaacccaccgttttctcggat
gtgaaggatgagatgctgatcgcaaatgatgagatctttggacctgttcagtccattctg
aaattcaaggatcttgatgaggcgataaggagggcgaataaatcgaggtacgggctagca
gcaggggtgttcacgcagaacctggacacggcgaataggctgatgagggcactgagggtt
gggagtgtgtggataaactgcttcgatgtgttcgatgcctctgttccgttcggagggtat
aagatgagtggcttcggacgagagaagggaatctacagtctcaataattacttgcaagtc
aaggcagttgttactcccctcaccaaccctgcctggctctag

DBGET integrated database retrieval system