KEGG   Tarenaya hassleriana (spider flower): 104825703Help
Entry
104825703         CDS       T04125                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
thj  Tarenaya hassleriana (spider flower)
Pathway
thj00010  Glycolysis / Gluconeogenesis
thj00020  Citrate cycle (TCA cycle)
thj00620  Pyruvate metabolism
thj01100  Metabolic pathways
thj01110  Biosynthesis of secondary metabolites
thj01200  Carbon metabolism
Module
thj_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:thj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104825703
   00020 Citrate cycle (TCA cycle)
    104825703
   00620 Pyruvate metabolism
    104825703
Enzymes [BR:thj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     104825703
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding DciA GCV_H
Motif
Other DBs
NCBI-GeneID: 104825703
NCBI-ProteinID: XP_010556375
LinkDB All DBs
Position
Unknown
AA seq 485 aa AA seqDB search
MAAAYSSFLSTPSLSSSKSTISFSSSVSASPLPCLRRVVFCSPSPASSRRRIMTVQSKIR
EIFMPALSSTMTEGKIVSWIKSEGEKLAKGESVVVVESDKADMDVETFYDGYLAAIVVSE
GETALVGAPIGLLAETEAEIEEAKAKAASKSSSSAAPAVAPSPHPATSSPAPAISQPAPA
ASVVPDGPRKTVATPFAKKLAKQHKVDIGSIVGTGPYGRITPADVEAAAGIAPSKPTANP
VVAAPPXAAAKASASNLPPTLPDSSVVPFTTMQAAVSKNMVESLSVPTFRVGYPVNTDAL
DALYEKVKPKGVTMTALLAKAAAMALAQHPVVNATCKDGKSFTYNSNINIAVAVSINGGL
ITPVLQDADKLDLYLLSQKWKELVGKARAKQLQPHEYSSGTFTLSNLGMFGVDRFDAILP
PGQGAIMAVGASKPTVIADSDGFFSVKNKMLVNVTADHRIIYGADLAAFLQTFAKIVENP
DSLTL
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggccgcggcttactcttcgttcctatcgacgccttctctctccagctccaaatccacc
atctccttctcctcttccgtctccgcttccccactcccatgcctccgccgcgtcgtcttc
tgctcaccatctccggcatcttcccgccgtagaatcatgaccgttcaatcgaagatcagg
gagatcttcatgcccgctctctcttccaccatgactgagggtaagatcgtttcatggatc
aaatccgaaggcgagaagctcgctaagggagagagtgtcgtcgttgtcgaatccgataaa
gccgacatggatgtggagaccttctacgacggatatctcgccgccattgtcgtcagcgag
ggtgagaccgctctggtcggagctccgatcggattgctggcggagacagaggccgagatt
gaggaggctaaagcgaaggccgcttcgaaatcatcctcctccgctgctcctgccgtcgct
ccctctcctcacccggcgacttcctctcccgctccggctatctctcagcccgctccggcg
gcttcggtggttccggatggacccaggaagacggttgcgacgccgtttgcgaagaagctc
gcaaagcagcacaaggtggatatcggatccattgtagggacgggaccgtacggaaggatt
acccctgctgacgtggaggccgctgcgggaatcgctccatcgaagcccaccgcgaacccc
gtcgtggcggctcccccnnnngcggcggcgaaagcctccgccagcaacttgccgccaacg
ttgcctgattccagtgtggttcccttcacaacgatgcaagcggcagtgtccaagaacatg
gtggagagtctctccgttcccacattccgcgttggttatcccgtgaacacagatgcactc
gatgcgctgtacgagaaggtgaagccaaagggtgtgacaatgactgcgcttttggcgaag
gctgcagccatggctcttgctcagcatcctgtggtgaatgcaacctgcaaagatggaaag
agctttacttacaatagtaacataaacattgcagtggctgtgtctatcaatggtggattg
atcacacctgttcttcaggatgcagataagttggatttgtacttgctatcccaaaaatgg
aaggagctggtggggaaagccagagctaagcaactgcaaccacatgagtacagctctggg
acattcactttatccaatctaggcatgtttggagtggataggttcgatgccattctcccc
ccaggccagggtgccatcatggctgttggagcctcaaagccgaccgtaatcgctgattct
gatgggttcttcagcgtgaaaaacaaaatgctggtgaatgtaacggcggatcaccggatt
atatacggtgccgacttggctgctttccttcagacatttgcaaagattgtggaaaaccca
gacagccttaccttgtag

DBGET integrated database retrieval system