KEGG   Tarenaya hassleriana (spider flower): 104826896Help
Entry
104826896         CDS       T04125                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial-like
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
thj  Tarenaya hassleriana (spider flower)
Pathway
thj00564  Glycerophospholipid metabolism
thj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:thj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    104826896
Enzymes [BR:thj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     104826896
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox Pyr_redox_2 GIDA Lycopene_cycl HI0933_like FAD_binding_3 NAD_binding_8 PIG-Y Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 104826896
NCBI-ProteinID: XP_010558142
LinkDB All DBs
Position
Unknown
AA seq 630 aa AA seqDB search
MSVNSLRRLAASAVVIAAASGGAVYLTPSVASSDRGGGRGSVLDSLKLRIGDPSATVPSR
SVQESGLIGASFSNPLDILVIGGGATGCGVALDASTRGLRVGLVEREDFSSGTSSRSTKL
IHGGVRYLEKAVFNLDYGQLKLVFHALEERKQVIDNAPHLCHALPCMTPCFDWFEVIYYW
MGLKFYDLVAGARLLHLSRYYSAQESVELFPTLARKGRDKSLKGTVVYYDGQMNDSRLNV
GLACTAALAGAVVLNHAEVVSLIKDDVTQRVIGARIHNNLSGQEFDTYAKVVVNAAGPFC
DTVRKMADKEAKPMICPSSGVHIVLPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTVAGT
TDSNTEITLLPEPHEDEIQFILDAICDYLNIKVRRSDVLSAWSGIRPLAMDPSAKSTESI
SRDHVVTEDCPGLVTITGGKWTTYRSMAEDAVDAAIKSGKLNPTNGCVTQRLQLVGAYGW
EPSSFTVLAQQYVRMKRTYGGKVVPGAMDTAAAKHLSHAYGTMAERVAAIAQDEGLGKRL
AHGYPFLEAEVAYCARHELCESAVDFIARRCRIAFLDTDAAGKALPRVIEILSAEHKWDK
SRQKHELRKAREFLQTFKSSKNARFHDGKH
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgaattccctccgccgccttgccgccagcgctgtcgtcattgccgccgcgtcc
ggaggcgccgtttacctgacgccgtccgtcgcctccagcgacagaggcggtggtcgaggt
tcagtgttggactcgcttaagcttcggattggtgatccgagcgctacggtcccttcgcga
tccgtccaggagtcgggtctgattggagcgagcttctctaatccgctcgacattctcgtc
atcggcggcggagccaccggttgcggagtggctctcgacgctagtactcgtggtcttcgt
gttggtcttgtcgagcgagaggacttctcgtccgggacttcttctcggtcaacaaagctt
atccatggaggggttcggtatctggaaaaagctgtttttaatcttgattacggacagctg
aagctagtttttcacgcgcttgaggagcgtaagcaggtcattgacaatgcaccacatctt
tgtcatgctctgccctgtatgacaccttgttttgactggttcgaggtaatctactactgg
atgggattgaagttttatgacttggtcgcaggagcacgtttattgcatttgtccagatat
tactctgcacaagagtcggtcgagctcttccccactcttgcgaggaaaggcagagacaag
agtttgaagggaactgtcgtatactatgatgggcaaatgaatgattcgcgtcttaatgtg
ggtttggcgtgtactgcagcattggctggtgctgtggtgctcaatcatgctgaggttgtt
tcccttataaaggatgatgtgactcagagggtaatcggtgcacggattcataacaattta
tcaggacaagagtttgacacctacgcaaaagtagttgtgaatgcggcaggacccttttgc
gacacggtaaggaagatggctgataaagaggcaaaaccaatgatatgtccaagcagtggt
gtacacattgtgttacctgattactattctcctgaaggaatgggattgatagttcctaaa
actaaggatggccgtgttgtcttcatgttaccgtggttgggaagaactgtagcaggaact
acagactctaacaccgagatcactttgcttccagaacctcatgaagatgaaattcaattc
attctggatgcaatttgtgactacctcaacatcaaggttcgacgcagtgatgttctttct
gcttggagtgggatacgtccattggccatggacccgtcagcaaagagcacggagagtatc
tccagagatcatgtagtcactgaggattgtcctggtttagttacaatcacaggtggaaag
tggactacatatcgaagcatggcagaagatgcggttgatgcagcgatcaaatccggaaaa
ctgaatccgaccaacggttgtgtaacccagagactacagctagtgggtgcttatggatgg
gagccgtcgtcattcacagttctcgcccaacaatacgtgcgtatgaagagaacctacggt
ggtaaagtcgtcccaggggcgatggacaccgctgcggcaaaacatctatctcatgcttat
ggcacaatggcggaacgagtcgctgccatagctcaggacgagggcctcgggaaacggctg
gctcacgggtacccgttcctagaagcggaggttgcgtattgcgcaaggcacgaattatgc
gaatcggcggtagatttcatagcgaggaggtgtcggatagcgtttctagacacagacgcg
gcagggaaggcgctgcctagggtgatagagatactgtcggccgaacacaaatgggacaag
tcgaggcagaaacacgagttgcgaaaggccagagagtttctccagactttcaagtcttcc
aagaacgctcggttccatgacggcaaacactaa

DBGET integrated database retrieval system