KEGG   Tarenaya hassleriana (spider flower): 104827229Help
Entry
104827229         CDS       T04125                                 

Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
thj  Tarenaya hassleriana (spider flower)
Pathway
thj00250  Alanine, aspartate and glutamate metabolism
thj00410  beta-Alanine metabolism
thj00430  Taurine and hypotaurine metabolism
thj00650  Butanoate metabolism
thj01100  Metabolic pathways
thj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:thj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    104827229
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    104827229
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    104827229
   00430 Taurine and hypotaurine metabolism
    104827229
Enzymes [BR:thj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     104827229
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Atg14
Motif
Other DBs
NCBI-GeneID: 104827229
NCBI-ProteinID: XP_010558669
LinkDB All DBs
Position
Unknown
AA seq 503 aa AA seqDB search
MVLSHTASESDVSVHSTFASRYVRASLPRFKLPENSTPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMSAINKNYVDMDEYPVTTELQNRCVNMIANLFNAPLGDDETAVG
VGTVGSSEAIMLAGLAFKRKWQNKRKADGKPHDKPNIVTGANVQVCWEKFARYFEVELKE
VKLREGYYVMDPEKAVEMVDENTICVAAILGSTLNGEFEDVKLLNDLLYKKNQETGWDTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRSKDDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGYEGYRNVMENCRDNMMVLKDGLQR
TGRFEIVSKDDGVPLVAFSLKDSSRHNEFEVSDMLRRFGWIVPAYTMPPDAQHITVLRVV
IREDFSRTLAERLVIDVQKVLHELDELPSRVIEKLSLGREENKEIGNDEVILKVKKSDIE
RQREIINGWKKLVSDRKKMNAIC
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggtgctatcgcacacagcgtcggagtcggacgtgtccgtccattccacgttcgcttcc
cgatacgttcgagcttctcttcccaggttcaagttaccggagaattcgacaccgaaggaa
gcagcgtatcagataataaacgacgagctgatgctggacgggaaccctcgtctgaacttg
gcgtcattcgtcacgacatggatggaacctgaatgcgacaagctcatcatgtccgccatc
aacaagaactacgtcgacatggatgagtatcccgtcaccaccgaactccagaaccggtgt
gtgaacatgatagcgaatctattcaacgcaccgctaggagatgatgagacggcggtggga
gtggggacggtgggatcgtcggaggccataatgttggccggtttggccttcaaacgcaag
tggcagaacaaacgcaaggccgatggtaaacctcacgacaaacccaacatcgtcaccggt
gccaatgtccaggtgtgctgggagaaattcgcgagatactttgaagtagagctgaaggaa
gtgaagctaagagaagggtactacgtgatggaccccgagaaagccgtggagatggtcgac
gagaacacgatctgtgtcgccgccatcctcggctccactctcaacggagagttcgaagac
gtcaagctcttgaacgacctcctctacaaaaagaaccaagaaacaggatgggatacgccg
atacacgtggacgctgcgagcggaggattcatagcgccgttcttgtacccggagctggaa
tgggatttcaggctgccactggtgaagagcataaacgtgagcgggcacaagtacggcctc
gtctacgccggaatcggttgggtcatttggagaagcaaagacgatttgcccgaggaactc
atcttccacatcaactatctcggggccgaccagcctactttcaccctcaacttctccaaa
ggttcaagccaagtcatagctcaatactaccaactcattcgtctgggctacgagggatac
agaaacgtgatggagaattgcagggacaacatgatggtattgaaggacgggctccagaga
acgggaaggttcgagatcgtctcaaaggacgacggtgtccctctcgtcgctttctctttg
aaggacagtagccgtcacaacgagttcgaggtctccgacatgctccgcaggttcggatgg
attgtaccggcgtacacaatgccaccggacgcacaacatatcactgttctccgagttgtt
ataagagaagatttctcgagaacgcttgccgaaaggctcgtgatcgatgttcagaaagta
ttgcacgaattagacgagttgccatcgagagttatcgagaagttatcgctcggccgggaa
gagaacaaagagatcgggaacgacgaggtgatcctgaaggtgaagaagagtgacatcgag
aggcagagagagatcatcaacggatggaagaagctcgtctccgacaggaagaagatgaat
gctatatgttaa

DBGET integrated database retrieval system