KEGG   Thauera sp. K11: CCZ27_00345Help
Entry
CCZ27_00345       CDS       T05106                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
thk  Thauera sp. K11
Brite
KEGG Orthology (KO) [BR:thk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CCZ27_00345
Enzymes [BR:thk01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CCZ27_00345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 HI0933_like DAO FAD_oxidored FAD_binding_3 K_oxygenase Thi4 AlaDh_PNT_C Glutaredoxin NAD_binding_8 FMO-like NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: ATE58616
UniProt: A0A290ZHY5
LinkDB All DBs
Position
65011..66579
Genome map
AA seq 522 aa AA seqDB search
MLDATIKTQLKAYLEKVTQPIEIVASLDDGEKSREMQALLADIAGLSDKITLSEVRDDAQ
RKPSFSLNRRGANLGVRFAGLPMGHEFTSLILALLQVGGHPPKAEAEVIEQIRGLEGEYH
FETYISLSCHNCPEVVQALNLMAVINPNVRHTMIDGALFQAEVDARKIMAVPTIFLNGEP
FGQGRMELGEILAKVDTGAAAREAQKLSARDAFDVLVVGGGPAGAAAAIYAARKGIRTGI
VAERFGGQVMDTMGIENFISVKETEGPKLVMALEEHVRQYGVDIMNLQRAAKVVPGSADG
STLARVQLENGGTLQAKTVILATGARWREMNVPGEKALRGKGVAYCPHCDGPLFKGKRVA
VIGGGNSGVEAAIDLAGVVSHVTLLEFAEELRADAVLQSKLHSLPNVKVIKSAQTTEVTG
ADKVTGLMYKDRASGDTHWLELEGIFVQIGLLPNTDFLKGTVELTKFGEIIVDAKGHTSV
PGVFAAGDCTTVPYKQIIIAMGEGAKASLSAFDHLIRTSAPA
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaccatcaagacccaactgaaagcctacctcgagaaggtcacgcagccg
atcgagatcgtcgcgtcgctggacgatggcgagaagtcgcgcgagatgcaggccctgctg
gccgacatcgcgggcctgagcgacaagatcacgctgagcgaggtgcgcgacgacgcgcag
cgcaagccctcgttctcgctcaaccgccggggcgccaacctgggcgtgcgtttcgccggt
ctgcccatgggccacgaattcacctcgctgatcctggcgctgctgcaggtgggcgggcac
ccgcccaaggccgaggcggaggtgatcgagcagatccgcgggctggagggcgaataccac
ttcgagacctacatctcgctgtcgtgccacaactgcccggaggtggtgcaggcgctcaac
ctgatggcggtgatcaacccgaacgtgcgccacacgatgatcgacggcgcgctgttccag
gccgaggtcgatgcgcgcaagatcatggcggtgccgacgatcttcctgaacggcgagccg
ttcgggcagggccgcatggagctgggcgagatcctcgccaaggtcgacaccggcgcggcg
gcgcgcgaggcgcagaagctgtcggccagggacgcgttcgacgtgctcgtggtcggcggc
ggtccggcgggggcggcggcggcgatctacgccgcgcgcaagggcatccgcaccggcatc
gtggccgagcgcttcggcgggcaggtgatggacacgatgggcatcgagaacttcatctcg
gtgaaggagaccgaggggcccaagctggtgatggcgctcgaagagcacgtgcgccagtac
ggggtcgacatcatgaacctgcagcgcgcggccaaggtggtgcccggcagcgcggacggc
agcacgctcgcccgggtgcagctcgagaacggcggcacgctgcaggcgaagacggtgatc
ctggccaccggggcgcgctggcgcgagatgaacgtgccgggcgagaaggcgctgcgcggc
aagggcgtggcgtactgcccgcactgcgacggcccgctgttcaagggcaagcgggtggcg
gtgatcggcgggggcaactcgggcgtggaagcggcgatcgacctggccggggtggtgtcg
cacgtgacgctgctcgagttcgccgaggaactgcgcgcggacgcggtgctgcagagcaag
ctccacagcctgcccaacgtgaaggtgatcaagagcgcgcagaccaccgaggtgaccggc
gccgacaaggtcaccgggctgatgtacaaggaccgggcgtcgggcgacacgcactggctc
gaactggaaggcatcttcgtgcagatcggcctgctgccgaacacggacttcctgaagggc
acggtggagctgacgaagttcggcgagatcatcgtcgatgccaagggccacacctcggtg
ccgggggtgttcgcggcgggcgactgcacgacggtgccgtacaagcagatcatcatcgcc
atgggcgaaggggcgaaggcgtcgctgtcggccttcgaccacctgatccgtacctcggct
ccggcctga

DBGET integrated database retrieval system