KEGG   Thauera sp. K11: CCZ27_02760Help
Entry
CCZ27_02760       CDS       T05106                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
thk  Thauera sp. K11
Pathway
thk00620  Pyruvate metabolism
thk00680  Methane metabolism
thk01100  Metabolic pathways
thk01120  Microbial metabolism in diverse environments
thk01200  Carbon metabolism
Module
thk_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:thk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CCZ27_02760
  09102 Energy metabolism
   00680 Methane metabolism
    CCZ27_02760
Enzymes [BR:thk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CCZ27_02760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: ATE59022
UniProt: A0A290ZJ80
LinkDB All DBs
Position
complement(594375..597131)
Genome map
AA seq 918 aa AA seqDB search
MTQDKDAPLREDIRLLGRLLGDTVRDQQGAAVFDLIERIRQNSVRFRRDDDIAARRELDD
MLDALSREQTIQVVRAFSYFSHLANIAEDQHHIRRSRAHLIAGSAPREGSLAHALQRAFD
SGSANAVSLQAFFETALVSPVLTAHPTEVQRKSILNCETVLARLLDERDRVQLTPEESEA
NLEALRRAVLTLWQTRMLRSARLSVIDEVNNGLSYFETTFLRELPRLYASLEDHLAGAAG
AGAMPAELPAFLQVGSWIGGDRDGNPYVTAEVLECALAMQAEVALNYYLDELHFLGSQLS
LALGLVSASDALLALAERSPDQSPHRSDEPYRRAISGIYARLAATYQALLGHAPVRHAIA
EAEPYPGAGALSEDLDILHRSLVANGSAALARGRLRHLRRAVKVFGFHLAPVDLRQNSDV
HERVVAELLEVARPGTGYRERDEAGRCALLLDELATARPLASPHVKYSDETESELAIFHA
ARRAHLRYGTAAIRQCIISKTDDVSDLLELAVLLKEAGLLRPVDKALDVNLVPLFETIGD
LENAAGVMDRLFSLPGYRELLASACDDAQEVMLGYSDSNKDGGFMTSGWALYKAEGELVD
VFARHGVRLRLFHGRGGSVGRGGGPSYQAILAQPEGAVQGQIRLTEQGEVIGAKYGNPEV
GRRNLEVLVAATLETSLRPAGTGPTPQAFLDAMQTLSDEAFAAYRGLVYETPGFEQYFWE
STVISEIAGLNIGSRPASRKKGTRIEDLRAIPWVFSWAQCRLMLPGWFGFGRAVKRFLAA
RPDDGLALLQRMHREWSFFATLLSNMDMVLAKSDLAIASRYAELVKDVALRESIFGRIRG
EWHDTVEVLLAITGQQELLDDNPLLKRSIRNRFPYLDPLNHVQVELLRRHREQGEDERIR
LGIHISINGIAAGLRNSG
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgacccaggacaaggacgcgcccctgcgcgaagacatccgcctgctcggccgccttctc
ggcgacaccgtgcgcgaccagcaaggcgccgccgttttcgacctgatcgagcgcatccgc
cagaattcggtgcgctttcgccgcgacgacgacatcgccgcgcggcgcgagctggacgac
atgctcgacgccctgtcgcgcgagcagacgatccaggtcgtccgcgccttcagctacttc
tcgcacctggcgaacatcgccgaggaccagcaccacatccgccgcagccgtgcgcacctg
atcgccggctccgcgccgcgcgaaggcagcctcgcccatgcgctgcagcgtgcattcgac
agcgggtcggcgaacgcggtcagcctgcaggcattcttcgagaccgcgctggtgtcgccg
gtgctgaccgcccacccgaccgaggtgcagcgcaagagcatcctcaactgcgagacggtg
cttgcccgcctgctcgacgagcgcgaccgcgtgcagctcacgcccgaggaatccgaagcc
aacctcgaggcgctgcgccgcgcggtgctgacgctgtggcagacgcgcatgctgcgctcc
gcgcggctgtcggtgatcgacgaggtcaacaacgggttgtcgtatttcgagaccaccttc
ctgcgcgagttgccgcgcctctacgcaagcctcgaagaccacctcgcgggcgccgccggc
gccggcgccatgccggccgaactgcccgccttcctgcaggtcggcagctggatcggcggc
gaccgcgacggcaacccctacgtcaccgccgaggtgctggaatgcgcgctcgccatgcag
gcggaagtcgcgctcaactactacctcgacgaactgcacttcctgggctcgcagttgtcg
ctcgcgctcggcctcgtcagcgcctccgacgcgctgctggcgctggccgaacgctcgccg
gaccagtcgccccaccgcagcgacgagccctaccggcgcgcgatttcgggcatctatgcc
cgccttgcggcgacctaccaggcactgctgggccacgccccggtacgccacgccatcgcc
gaggccgaaccgtatccgggggccggggcgctgagcgaggatctggacatcctgcaccgc
tccctggtggccaacggttcggccgcgctggcccgcggccgcctgcgccacctgcggcgc
gcggtgaaggtgttcggcttccatctggcaccggtcgacctgcgccagaactccgacgtg
catgaacgcgtcgtcgccgaactgctggaagtcgcccgccccggcaccggctatcgcgaa
cgggacgaggccggccgctgcgcgctgctgctcgacgaactcgccaccgcacgcccgctc
gcctcgccgcacgtcaaatactccgacgagaccgaatccgaactcgccatcttccacgcc
gcccgccgcgcccacctgcgctacggcacggcggccatccgccagtgcatcatctccaag
accgacgacgtctccgacctgctcgaactcgcggtgctgctgaaggaggccggcctgctg
cgcccggtcgacaaggcgctggacgtcaacctcgtgccgctgttcgagaccatcggcgac
ctcgagaacgccgccggcgtgatggaccgcctgttctcgctgccgggctaccgcgaactg
ctcgccagcgcgtgcgacgacgcccaggaagtgatgctcggctactctgacagcaacaag
gacggcggcttcatgacctccggctgggcgctgtacaaggccgagggcgaactggtcgac
gtcttcgcccgccacggcgtgcgcctgcggctgttccacggccgcggcggctcggtgggc
cgcggcggcgggccgagctaccaggccatcctggcgcagcccgaaggcgcggtgcagggt
cagatccgcctcaccgagcagggcgaggtgatcggcgccaagtacggcaacccggaagtc
ggccgccgcaacctggaggtgctggtcgccgccacgctggaaaccagcctgcggccggcc
ggcaccggtcccacgccgcaagccttcctcgacgcgatgcagacgctgtcggacgaagcc
ttcgccgcctaccgcggcctggtctacgagacgccgggcttcgagcagtacttctgggaa
tcgacggtgatctccgagatcgccggcctgaacatcggctcgcgcccggcgtcgcgcaag
aagggcacgcgcatcgaggatctgcgcgcgatcccgtgggtgttctcgtgggcgcagtgc
cggctgatgctgccgggctggttcggcttcggccgcgcggtgaagcgcttcctcgccgcg
cggccggacgacggcctggcgctactgcagcgcatgcaccgcgagtggtcgttcttcgcc
acgctgctgtcgaacatggacatggtgctcgccaagagcgaccttgcgatcgcctcgcgc
tacgccgaactggtgaaggacgtcgccctgcgcgaaagcatcttcggccgcatccgcggc
gagtggcacgatacggtggaggtgctgctggccatcaccggccagcaggaactgctcgac
gacaaccccctgctcaagcgttcgatccgcaaccgcttcccctatctcgacccgctcaac
cacgtgcaggtcgaactgctgcgccgccaccgcgagcagggcgaggacgaacgcatccgg
ctcggcatccacatctccatcaacggcatcgccgccgggctgcgcaacagcggctga

DBGET integrated database retrieval system