KEGG   Thauera sp. K11: CCZ27_13105Help
Entry
CCZ27_13105       CDS       T05106                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
thk  Thauera sp. K11
Pathway
thk00564  Glycerophospholipid metabolism
thk01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:thk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CCZ27_13105
Enzymes [BR:thk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CCZ27_13105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored NAD_binding_8 HI0933_like Pyr_redox_2 GIDA Pyr_redox_3 FAD_binding_3 Pyr_redox Thi4 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ATE60762
UniProt: A0A290ZP87
LinkDB All DBs
Position
complement(3023160..3024728)
Genome map
AA seq 522 aa AA seqDB search
MRTPDPSRPALIARLRGRRNWDVIVVGGGATGLGCAVDAAARGHSVLLLEARDFAAGTSS
RATKLIHGGVRYLAQGRFALVREALAERARLLENAPHLVQPLRFVVPAYRWYDRPLIGAG
LAAYDLLAGGGLGRRRLLDAARTVAALPTVRTEGLCGGVAYMDAQFDDARLALALARTVF
DLGGTAINHCEVSGLAVEGGRVCGVRVRDCETGEAYDAAARVVINAAGVWADTVRRLADP
AVPGLLRPSQGVHLVVGREFLPGPDAMLVPRTADGRVLFAIPWQGRVLLGTTDTPRPDAP
FEPRPLPGEVDFILATAARHLARAPGRADVLSAFVGLRPLIGVGEASATRNLSREHVVDV
SSGGLVSVTGGKWTTYRLMAQDAVDAAQSVAGLPRRDSPTARLPLHGAPRADGAAAPKDP
YGTDREQVDRLPGARRRLVEGFTLTEAEVRYAARAEFARTVEDVLARRHRALFLDAALAA
EAAPAVAAILAEERGVGADWCAAECARFSALAARYRDPGAED
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaccccggacccatcgcgccccgcgctgatcgcacgcctgcgcgggcggcgcaat
tgggacgtgatcgtcgtcggcggcggcgccaccggcctgggctgtgccgtcgatgccgcc
gcgcgcggccattcggtgctgttgctggaagcgcgcgactttgccgccggcaccagttcg
cgtgccaccaagctcatccacggcggcgtgcgctacctggcgcaggggcgcttcgccctg
gtgcgcgaagcgctcgccgaacgcgcgcggctgctcgagaacgctccccacctggtgcag
ccgctgcgcttcgtggtgccggcctaccgctggtacgaccggccgctaatcggcgccggg
ctggccgcgtacgacctgctcgccggcggcggccttggccgccgccgcttgctcgatgcc
gcgcgcacggtggcggcgctgcccacggtgagaacggaagggctgtgcggcggcgtggcc
tacatggatgcgcagttcgacgacgcacgtcttgcgctggcgctcgcgcgcacggtgttc
gatctgggcggaacggcgatcaaccactgcgaggtgagcggcctcgccgtcgaaggcggc
cgcgtctgcggcgtgcgtgtccgggactgcgaaacgggcgaagcgtacgacgcggctgcc
cgggtggtgatcaatgccgccggcgtgtgggccgataccgtccgccgcctggccgatccg
gccgtgccgggcctgttgcgcccgagccagggcgtgcacctggtcgtcggccgcgagttc
ctgcccggcccggatgccatgctggtgccgcgcacagccgatgggcgggtgctgttcgcg
atcccgtggcagggcagggtgctgctcggcaccaccgacacgccgcgtccggatgcaccg
ttcgagccgcgtccgctgccgggcgaggtggatttcatcctcgccacggccgcccgccat
ctggcgcgggcgccgggccgcgccgacgtgctcagcgcattcgtcgggctgcggccgctg
atcggtgtcggcgaggcctcggccacccgcaacctgtcgcgggagcacgtcgtcgacgtg
tcgtccggcgggctggtcagcgtgaccggcggcaaatggacgacctaccgcctgatggcg
caggacgcggtcgacgcggcgcagtcggtggcgggcctgccgcggcgcgactcgccgacc
gcgcgcctgccgctgcatggcgcgccgcgggcggacggcgcggcggcgccaaaagacccc
tacggcaccgaccgcgagcaggtcgaccggctgcccggcgcgcgccgccggctggtcgaa
ggcttcacgctgaccgaggccgaggtgcgatatgccgcgcgcgccgaattcgcccgcacg
gtggaggatgtcctggcgcggaggcatcgggcgctgttcctcgatgccgcgctggcggcc
gaggccgctcccgcggtggccgccatcctggcggaggaaaggggtgtcggcgccgactgg
tgcgcggccgagtgcgcgcgcttttccgccctggccgcccgctaccgcgatccgggcgcg
gaggactga

DBGET integrated database retrieval system