KEGG   Thauera sp. K11: CCZ27_13880Help
Entry
CCZ27_13880       CDS       T05106                                 

Definition
(GenBank) ribulose bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
thk  Thauera sp. K11
Pathway
thk00630  Glyoxylate and dicarboxylate metabolism
thk01100  Metabolic pathways
thk01120  Microbial metabolism in diverse environments
thk01200  Carbon metabolism
Module
thk_M00165  Reductive pentose phosphate cycle (Calvin cycle)
thk_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:thk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CCZ27_13880
Enzymes [BR:thk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     CCZ27_13880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ATE60884
UniProt: A0A290ZPE9
LinkDB All DBs
Position
3180700..3181125
Genome map
AA seq 141 aa AA seqDB search
MRITQGCFSYLPDLTDAQIAAQVDYCLRQGWAVSLEYTDDPHPRNTYWAMWGLPMFDLRD
PAGAMAELGACREANPETYIRINAFDPTRGWETVRMSFIVQRPAAEPGFRLVRQETKGRS
LHYTMESYAVDRSPEGARYNR
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcacccaaggctgcttttcctacctgcccgacctcaccgacgcgcagatcgcc
gcccaggtcgactattgcctccgccagggctgggcggtgtcgctcgaatacaccgacgac
ccgcacccgcgcaacacctactgggccatgtggggcctgccgatgttcgacctgcgcgac
cccgccggcgcgatggccgaactcggggcctgccgcgaagccaaccccgaaacctacatc
cgcatcaacgccttcgatccgacccgcggctgggagacggtgcgcatgtccttcatcgtc
cagcgccccgccgccgaaccgggcttccgcctcgtccgccaggaaacgaagggccgcagc
ctgcactacacgatggaaagctacgcggtagaccgaagccccgaaggcgcccgctacaac
cgctag

DBGET integrated database retrieval system