KEGG   Thauera sp. K11: CCZ27_14940Help
Entry
CCZ27_14940       CDS       T05106                                 

Definition
(GenBank) dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
thk  Thauera sp. K11
Pathway
thk00290  Valine, leucine and isoleucine biosynthesis
thk00770  Pantothenate and CoA biosynthesis
thk01100  Metabolic pathways
thk01110  Biosynthesis of secondary metabolites
thk01130  Biosynthesis of antibiotics
thk01210  2-Oxocarboxylic acid metabolism
thk01230  Biosynthesis of amino acids
Module
thk_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
thk_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:thk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    CCZ27_14940
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    CCZ27_14940
Enzymes [BR:thk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     CCZ27_14940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ILVD_EDD Pullulanase_N2
Motif
Other DBs
NCBI-ProteinID: ATE61063
UniProt: A0A290ZPV9
LinkDB All DBs
Position
complement(3409967..3411817)
Genome map
AA seq 616 aa AA seqDB search
MPQYRSRTSTAGRNMAGARALWRATGMKDGDFEKPIIAIANSFTQFVPGHVHLKDLGQLV
AREIEAAGGVAKEFNTIAVDDGIAMGHGGMLYSLPSRELIADSVEYMCNAHTADALVCIS
NCDKITPGMLMAALRLNIPAIFVSGGPMEAGKVKWEAKVISLDLVDAMVKAADKHCSDEE
VEAIERSACPTCGSCSGMFTANSMNCLTEALGLSLPGNGTTLATHADRERLFREAGRRIV
DLARRCYEGDDASVLPRSIASFEAFENAMSLDVAMGGSTNTVLHLLAAAREAGVDFTMKD
IDRISRRVPCLCKVAPAVPDVHIEDVHRAGGIMSILGELDRAGLLHTDVPTVHSASMAEA
LAKWDIKRTSDETVHTFFRAAPGGVPTQVAFSQDRRWKELDADREAGVIRTREHAFTADG
GLAVLYGNIAEKGCIVKTAGVDESIWTFTGKARVYESQEDAVDGILGEQVQAGDVVVIRY
EGPKGGPGMQEMLYPTSYLKSRGLGAQCALLTDGRFSGGTSGLSIGHASPEAACGGAIAL
VEDGDTIEIDIPNRRIHLEVGEEELARRRAAMEARGRAAWRPARRERAVSAALQAYAALT
TSADTGAVRDVTQVQR
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgccccagtaccgttcccgcacttccaccgccggccgcaacatggcgggtgcccgcgcg
ctgtggcgcgccaccggcatgaaggacggcgacttcgaaaagccgatcatcgcgatcgcc
aacagtttcacccagttcgtgccgggccacgtgcacctgaaggacctcggccagctcgtc
gcgcgcgagatcgaggcggccggcggcgtggccaaggaattcaataccatcgccgtcgac
gacggcatcgccatgggccacggcggcatgctgtactcgctgccctcgcgcgagctgatc
gccgacagcgtcgaatacatgtgcaacgcccacaccgccgacgcgctggtgtgcatctcg
aactgcgacaagatcaccccgggcatgctgatggcggcgctgcgcctcaacatcccggcg
atcttcgtgtccggcgggccgatggaggctggcaaggtgaaatgggaagccaaggtgatc
tcgctcgacctcgtcgacgcgatggtcaaggcggccgacaagcactgctccgacgaggag
gtcgaggccatcgagcgctccgcctgtccgacctgcggctcgtgctcgggcatgttcacc
gccaactcgatgaactgcctgaccgaggcgctcggcctgtcgctgcccggcaacggcacc
acgctcgccacccatgccgaccgcgagcgcctgttccgcgaagccggccgccgcatcgtc
gatctcgcccgtcgctgctacgaaggggacgacgcctcggtgctgccgcgctccatcgcc
agcttcgaggcgttcgagaacgcgatgagcctggacgtggcgatgggcggctcgaccaac
accgtgctgcacctgctggcggcggcacgcgaggccggcgtcgatttcacgatgaaggac
atcgaccgcatcagccgccgcgtgccctgcctgtgcaaggtggcgccggcggtgcccgac
gtgcacatcgaggacgtgcaccgcgccggcggcatcatgtccatcctcggcgaactcgac
cgcgccggcctgctgcacaccgacgtgccgacggtgcacagcgcgtcgatggccgaggcg
ctggcgaagtgggacatcaagcgcacctccgacgagaccgtgcataccttcttccgcgcc
gcgcccggcggcgtgccgacccaggtcgccttcagccaggaccggcgctggaaggaactc
gacgccgaccgcgaggcgggcgtcatccgcaccagggaacacgccttcaccgccgacggc
ggcctcgcggtgctgtacggcaacatcgccgagaagggctgcatcgtgaagacggccggc
gtggacgagtcgatctggacattcaccggcaaggcgcgggtgtacgagagccaggaagac
gcggtcgacggcatcctgggcgagcaggtgcaggccggcgacgtggtggtgatccgctac
gagggcccgaagggcggccccggcatgcaggagatgctctaccccacgtcctacctgaag
agccgcggcctgggcgcgcagtgcgcgctgctcaccgacggccgcttctccggcggcacg
tccggcctgtcgatcggccacgcctcgcccgaggcggcctgcggcggcgccattgcgctc
gtcgaggatggcgacacgatcgagatcgacatccccaaccgccgcatccacctggaggtc
ggcgaggaagaactcgcccgccggcgcgctgcgatggaagccaggggccgtgcggcatgg
aggccggccaggcgcgaacgcgcggtgtcggcggcgctgcaggcttacgcggcgctcacc
acctcggccgacaccggcgcggtgcgcgacgtgacccaggtccagcgctga

DBGET integrated database retrieval system