KEGG   Thauera sp. K11: CCZ27_21205Help
Entry
CCZ27_21205       CDS       T05106                                 

Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
thk  Thauera sp. K11
Pathway
thk00970  Aminoacyl-tRNA biosynthesis
thk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thk00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CCZ27_21205
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:thk03029]
    CCZ27_21205
Enzymes [BR:thk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CCZ27_21205
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CCZ27_21205
Mitochondrial biogenesis [BR:thk03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CCZ27_21205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey YqeY
Motif
Other DBs
NCBI-ProteinID: ATE62155
UniProt: A0A290ZT17
LinkDB All DBs
Position
complement(4862156..4863616)
Genome map
AA seq 486 aa AA seqDB search
MSRTDWEVVIGLEVHAQLNTASKIFSGASTAFGAEPNRQASAVDIALPGVLPVLNRGAVE
RAIRFGLAIGAHVAPTSVFARKNYFYPDLPKGYQISQFELPVVQGGEITIRVGDGDKAYE
KTVRLTRAHLEEDAGKSLHEDFHGMTGIDLNRAGTPLLEIVSEPDMRSSAEAVAYARTLH
ALVRWIDICDGNMQEGSFRCDANVSVRKKGATEFGTRREIKNLNSFRFLQQAIDYEVQWQ
IGTIEDGGRIVQATVLFDPDTGETRMMRTKEDAHDYRYFPDPDLLPLVVSDAWQARVQAG
MPELPGAMKARFMDEWGLSAYDATTLTASKEVADFYQATVSAAGAALAKPCANWVMGDLA
ARLNKAELDVVASPVSPAQLAGLVARIADGTISNAIGKKVFDALWNGEGATADEIIDKQG
LKQVTDTGAIEAILDEVLAANQKSVEEFRAGKEKAFNALVGQAMKASKGKANPAQVNELL
RKKLGG
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaaccgattgggaagtcgtcatcgggctggaagtgcatgcccagctcaacacc
gcgagcaagatcttttccggcgccagcaccgccttcggtgccgagcccaaccgccaggcg
agcgcggtggacatcgcgctgccgggcgtgctgccggtgctcaaccgcggcgcggtggaa
cgcgcgatccgcttcggcctggcgatcggcgcccacgtcgcccccaccagcgtgttcgcg
cgcaagaactacttctacccggacctccccaagggctaccagatcagccagttcgagctg
ccggtggtgcagggcggcgagatcacgatccgcgtcggcgatggcgacaaggcctacgag
aagaccgtgcgcctgacccgcgcccacctcgaagaagacgccggcaagagcctgcacgag
gacttccacggcatgaccgggatcgacctcaaccgcgccggcacgccgctgctggagatc
gtgtccgagcccgacatgcgctcgtcggccgaagccgtggcctacgcccgcacgctgcat
gcgctggtgcgctggatcgacatctgcgacggcaacatgcaggaaggctccttccgctgc
gacgccaacgtgtcggtgcgcaagaagggcgcaaccgagttcggcacgcggcgcgagatc
aagaacctgaactccttccgcttcctgcagcaggcgatcgactacgaggtgcagtggcag
atcggcaccatcgaggacggcggccgcatcgtgcaggcgaccgtgctgttcgaccccgac
accggcgagacgcgcatgatgcgcaccaaggaagacgcgcacgactaccgctacttcccc
gaccccgacctgctgccgctggtggtctccgacgcgtggcaggcgcgcgtgcaggccggg
atgcccgagttgccgggcgcgatgaaggcgcgcttcatggacgaatggggcctgtcggcc
tacgacgcgacgacgctcaccgcctccaaggaggtcgccgacttctaccaggccacggtg
tcggccgccggcgcggcgctcgccaagccctgcgccaactgggtgatgggcgacctcgcc
gcgcgcctgaacaaggccgagctcgacgtcgtcgcctcgccggtgtcgcccgcgcagctc
gccggcctggtggcgcgcatcgccgacggcacgatctccaacgccatcggcaagaaggta
ttcgacgcgttgtggaacggcgaaggcgcgaccgccgacgagatcatcgacaaacagggc
ctgaagcaggtcaccgacaccggcgccatcgaggccatcctcgacgaggtgctggcggcc
aaccagaaatcggtcgaggaattccgcgccggcaaggagaaagccttcaacgcgctggtc
ggccaggcgatgaaggccagcaagggcaaggccaaccccgcgcaggtgaacgagctgctg
cgtaagaagctgggcggctga

DBGET integrated database retrieval system