KEGG   Tetragenococcus halophilus: TEH_00990Help
Entry
TEH_00990         CDS       T01640                                 

Definition
(GenBank) arabitol-phosphate dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
thl  Tetragenococcus halophilus
Pathway
thl00040  Pentose and glucuronate interconversions
thl00051  Fructose and mannose metabolism
thl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    TEH_00990
   00051 Fructose and mannose metabolism
    TEH_00990
Enzymes [BR:thl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     TEH_00990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C ThiC_Rad_SAM ADH_N_2 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 11258975
NCBI-ProteinID: BAK93426
UniProt: G4L3W0
LinkDB All DBs
Position
111678..112724
Genome map
AA seq 348 aa AA seqDB search
MKAVTKKEAGYDKMSLEALEIPVPKEDEILIEVAYTGICGSDIHTFKGEYKNPVTPVALG
HEFSGRVAQVGENVMKFKPMDRVTSQTTFYVCGQCTYCKKEQYNLCPYRKGIGTQQNGSL
AKYVIAKEKYAHKLPENLSYEGAAMSEPLSCCVHAMYQRSPLDLHDTILVMGPGPIGLFL
VQIAKEIGATVIVTGISKDSERLELAQKFGADAIVDTQTQDLTKVVNQLTDNVGVTKVYD
ASGSAVAVNQALPLMKKGGDFVQVGLFKDKFEKLDVETIIQREIHYIGSRSQNPYDWPIA
LHLLAKGAIDVSTMVTKKFPLEEWRTAFESVMSGDEVKVMIQSGTSFS
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgtaacaaaaaaagaggccggatatgacaaaatgtctcttgaggcactagaa
attccagttcctaaagaagatgaaatcttgattgaagttgcttatacaggaatttgcggt
tcagatatccatacatttaagggtgagtataaaaatccagtaaccccagttgctttagga
catgaattttcaggacgtgtcgctcaagtaggagaaaacgttatgaaatttaaacctatg
gatcgtgtaacgagtcaaacaactttttatgtttgcggacaatgtacttactgcaaaaaa
gaacaatataatctttgtccttatcgtaaaggcattggtactcagcaaaatggatctttg
gcaaaatatgttatcgccaaagaaaaatatgcgcataaattaccagaaaatttaagttac
gaaggagcagctatgtcagaacctttgtcatgttgcgtccatgctatgtatcaaagaagc
cccttagatcttcatgatacaatcctagttatgggaccggggcctattggtctgttctta
gttcaaattgcgaaagagattggcgcaacagtcattgttactgggatctcaaaagatagc
gagcgcttagaattagcacaaaaatttggcgcagacgcgatcgttgatacccaaacgcaa
gatttaacaaaagtcgtcaaccagctgacagataatgttggtgtaactaaagtttatgac
gcttcaggctcagctgtagccgttaatcaagctttgcctttaatgaaaaaaggcggagac
tttgttcaagtcggtttatttaaagataagtttgaaaagttagatgtagaaacgattatt
caaagagagattcattatattggaagccgatcacaaaatccatatgactggccaattgcc
ttacatttattagctaaaggtgccattgacgtttctaccatggtaacaaaaaagtttcct
ttagaagaatggcgaacagcttttgaaagtgtgatgtcaggagatgaggttaaagtaatg
attcaatcaggaacaagttttagctaa

DBGET integrated database retrieval system