KEGG   Tetragenococcus halophilus: TEH_01540Help
Entry
TEH_01540         CDS       T01640                                 

Definition
(GenBank) hypothetical protein
  KO
K23393  lipid II isoglutaminyl synthase (glutamine-hydrolysing) [EC:6.3.5.13]
Organism
thl  Tetragenococcus halophilus
Pathway
thl00550  Peptidoglycan biosynthesis
thl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    TEH_01540
Enzymes [BR:thl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.13  lipid II isoglutaminyl synthase (glutamine-hydrolysing)
     TEH_01540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1727 Mur_ligase_M Zn_Tnp_IS1595 A2L_zn_ribbon OrfB_Zn_ribbon zf-TFIIB zinc_ribbon_10 DUF2752
Motif
Other DBs
NCBI-GeneID: 11259015
NCBI-ProteinID: BAK93481
UniProt: G4L4D1
LinkDB All DBs
Position
complement(174650..176002)
Genome map
AA seq 450 aa AA seqDB search
MGFRSYIASFVGKSSQWFLKTFTKGGSSLPGKLALKIDPAILDRLASDYKVVVVTGTNGK
TLTTALTVNILQQEFDDVLTNPTGANMVQGIVSTFLSANPKNEQKKFAVLEIDEASLSKV
TDYIKPELFVFTNIFRDQMDRYGEIYTTYQLIVDGAAKSPEATILANGDSPIFNSLETTN
PRKYYGFDHESDEEQMAHYNTDGVLCPKCQHILHYKMITYANLGKYYCPNCGFTRPQLDY
KLTDLRNMTNTSAEFTIDNNDYKLEVGGMYNIYNALAATAVAEYYHVAPEKIRKGIGFDE
KVFGRQEVVDIDGKKCTLVLVKNPVGLNQVIDMIGLSPYNFSLVSLLNANYADGTDISWI
WDGNYEAFSNTEIPKVISGGERHEDMTKRLKVAGISEDKITETQNLDEVIEQIKQLPSEQ
VYILSTYTAVLQLRKKLADMGYIKGGMDRG
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgggatttcgaagttatattgcttcttttgtaggaaagagttcgcaatggtttttaaaa
acttttactaaaggcggatcaagtttaccgggaaaattagctttaaaaattgatccagct
attttagatcgcttggccagtgattataaagtggttgttgttactggtacaaatggcaaa
acgttaacaaccgcattaacagttaatattttacaacaagaatttgatgatgtattaacc
aacccaacaggcgccaatatggtacaaggaattgtttctacttttctttctgctaaccct
aaaaatgaacagaagaaatttgctgttttagaaattgacgaagcaagtttgagtaaggtc
actgactatattaagccagaattatttgtctttacaaacatttttcgcgatcaaatggat
cgctatggcgaaatttatacaacttatcagttaattgtcgatggtgcagcaaaatcaccg
gaagccaccattttagccaacggtgactcaccgatctttaattcacttgaaacaacaaat
cctagaaaatattatggttttgatcatgagtcggatgaagagcaaatggcacattacaat
acggacggcgtgttatgtcctaagtgccaacacattctacattataaaatgatcacctat
gcaaacctaggtaaatattattgtccaaattgcggctttacgcgcccccaattagattat
aagttaacagacttgcgaaacatgactaatacctcggcagaatttacaatcgacaataac
gattataaattagaagtcggtggtatgtataatatatataatgccctagcggcaaccgct
gtagctgaatattaccatgttgcaccagaaaaaatccgtaagggaattggttttgacgaa
aaagtttttggccgtcaggaagttgtagatattgacggtaaaaaatgtaccttggtttta
gttaaaaatcccgttggtctaaatcaagtcattgatatgattggtttatcgccttataat
ttctctcttgtttctttactaaacgctaattatgccgatggtacagatattagttggatt
tgggacggaaattacgaagcctttagcaatacagagataccaaaagtaatttccggcggg
gaacgtcatgaagatatgaccaaacgtttaaaagtagcaggtatttccgaagataaaatt
acagaaacacagaatttagatgaggtcattgaacagatcaaacaattacccagcgaacaa
gtttatattctatcaacctatactgctgttttacaattacgtaaaaagctagcagatatg
ggatatataaaaggaggtatggatcgtggctga

DBGET integrated database retrieval system