KEGG   Tetragenococcus halophilus NBRC 12172: TEH_07570
Entry
TEH_07570         CDS       T01640                                 

Gene name
murG
Definition
(GenBank) UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
  KO
K02563  UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [EC:2.4.1.227]
Organism
thl  Tetragenococcus halophilus NBRC 12172
Pathway
thl00550  Peptidoglycan biosynthesis
thl01100  Metabolic pathways
thl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:thl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    TEH_07570 (murG)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    TEH_07570 (murG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:thl01011]
    TEH_07570 (murG)
Enzymes [BR:thl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.227  undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase
     TEH_07570 (murG)
Peptidoglycan biosynthesis and degradation proteins [BR:thl01011]
 Precursor biosynthesis
  Glycosyltransferase
   TEH_07570 (murG)
SSDB
Motif
Pfam: Glyco_transf_28 Glyco_tran_28_C Glyco_transf_4 UDPGT Glyco_trans_4_2 Glyco_trans_4_4 CmcI MIT_C ALG11_N
Other DBs
NCBI-GeneID: 11261195
NCBI-ProteinID: BAK94084
UniProt: G4L6B0
LinkDB
Position
775618..776709
AA seq 363 aa
MKILVTGGGTGGHIYPGLAFINYVKKISSDSSFLYVGAKRGMENKILPQTDIPFLTLEIQ
GFKRKLTFENFKTIQLFLKSIRQAKKIIKDFQPDVVIGTGGYVSGAVVYAASKLNVPTVV
HEQNSVPGITNKFLARYVDKVGIAFKDAAQYFPKDKTVLVGNPRAQEIVGIQRSDLLRDF
DLDPEKKTLLVFGGSQGALKINQAIVAAIPEFAKKDYQILYASGERYYEEINETIGMTKD
AFTNISIKPYIKNMTEVMANCELLVGRAGATSIAEFTGLGLPAVLIPSPYVTNDHQAKNA
MSLVNNGAAKMIKDDQLTAENLVATVDEIMEDDTLLQQMAAESKKQGIPDAAQRLYQLVQ
SII
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgaaaatattagttacaggcggaggcacaggcggtcatatttatcctggactagctttt
atcaactatgtaaaaaaaattagttcagactcttccttcttgtatgtaggtgcaaaacga
gggatggagaacaaaattttaccgcaaacagatattccttttctaactttagaaattcaa
ggctttaaacgcaaactaacttttgaaaactttaaaacgattcaattgttcttaaaaagt
attcgacaagccaaaaaaataatcaaggattttcaaccagatgtggtcatcggaacaggt
ggctatgtttcaggtgctgttgtttatgcggcttccaaattaaatgttcctacagtggtt
catgagcaaaatagcgtgccaggaattaccaataagtttttagctcgttatgttgataaa
gtgggtattgcctttaaagatgcagcgcaatattttcctaaagataaaaccgttctagta
ggaaatcctagagcacaggaaattgttggaatacagcgttcggacttgttacgcgatttt
gatcttgacccagaaaagaagacacttttagtgtttggaggtagccaaggcgcattaaag
atcaaccaagccatagtagctgcaattcctgaatttgctaaaaaagactatcaaattctt
tatgcttccggagaacgctactacgaagaaattaatgaaacaattggcatgactaaagat
gcttttaccaatattagtataaagccctatataaaaaatatgacagaagtaatggctaat
tgtgagttattagttggtcgtgccggggcaacttcaattgctgaatttacgggtttaggt
ttacctgctgttttaatcccgagtccttatgtaactaatgatcaccaagcaaaaaatgca
atgagtttagtcaataatggggccgctaaaatgattaaagacgaccaattgacagctgag
aacttagtcgctaccgtagatgaaattatggaagatgatacacttttacaacaaatggca
gcagaatcaaaaaaacaagggataccagatgcagcgcaacgtttatatcaattggtgcag
tcaattatttaa

DBGET integrated database retrieval system