KEGG   Tetragenococcus halophilus NBRC 12172: TEH_13040
Entry
TEH_13040         CDS       T01640                                 

Gene name
uvrB
Definition
(GenBank) UvrABC system protein B
  KO
K03702  excinuclease ABC subunit B
Organism
thl  Tetragenococcus halophilus NBRC 12172
Pathway
thl03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:thl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    TEH_13040 (uvrB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:thl03400]
    TEH_13040 (uvrB)
DNA repair and recombination proteins [BR:thl03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     TEH_13040 (uvrB)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      TEH_13040 (uvrB)
SSDB
Motif
Pfam: UvrB_inter UvrB Helicase_C ResIII UVR DEAD AAA_7 AAA_30 AAA_19 AAA_5 Kinesin Microtub_bd AAA AAA_25 T2SSE UB2H
Other DBs
NCBI-GeneID: 11261049
NCBI-ProteinID: BAK94631
UniProt: G4L7V7
LinkDB
Position
1300579..1302561
AA seq 660 aa
MIEKELSHQFELVSNYQPSGDQPEAIEELTDGVLDHKKAQILLGATGTGKTYTISNVIQN
VNKPTLIIAHNKTLAGQLYGEFKEFFPNNAVEYFVSYYDYYQPEAYVPSSDTYIEKDSSI
NDEIDKLRHSATSSLLERNDVVVVASVSCIFGLGSPMEYQKQVVSLRQGMEISRDELLHS
LIDIQFERNDIDFQRGRFRVRGDVVEIFPASRAERALRVEFFGDEIDRIREVDALTGEIL
NETEHVSIFPATHFVTDEDHMETAIASIKQELDTRLAILKENNKLLEAQRLEQRTNYDIE
MLREMGYTSGIENYSRHMDGREEGEPPYTLLDFFPEDFLIVIDESHVTMPQIRGMYNGDR
ARKQMLVDYGFRLPSALDNRPLRLEEFEKHVNQIIYVSATPGPYEYDQTDTVVEQIIRPT
GLLDPVIDVRPIMGQIDDLVGEINERVERDERVFVTTLTKKMAEDLTDYFRELGIKVKYL
HSDIKTLERTEIIRNLRLGEFDVLVGINLLREGLDVPEVSLVAILDADKEGFLRSERSLV
QTMGRAARNADGEVVMYADKVTDSMQNAIDETTRRRKIQEAYNEEHGIVPQTVKKDVRDL
ISISSVTEEGEEKQVSYEDLTKDEKEDLIEKLNTEMKEAAKSQNFEKAANLRDSILELKA
NT seq 1983 nt   +upstreamnt  +downstreamnt
atgattgaaaaagaattatcacatcaatttgaacttgtttcaaattatcagccgtcaggg
gaccaacctgaagcaattgaagaattaactgatggggtgttagatcataaaaaggctcaa
attcttttaggtgctaccggaacggggaagacttatactatttcaaatgtgatccaaaat
gtaaataagccaacactgattattgctcacaataaaacactagcgggtcagctatatgga
gaatttaaggaatttttccctaataatgcggtggagtacttcgtaagttattatgattat
tatcaaccagaagcttacgtcccatcaagcgatacttatattgaaaaagattccagtatt
aatgatgaaattgataaattacgccattcagccactagctcgttattagaacgtaatgac
gttgttgttgttgcttcagtatcgtgtatttttggtttgggttcaccaatggaatatcaa
aaacaagttgtttctttgcgtcaaggaatggaaatctctcgagatgaattattacactca
ttgatcgatatccaatttgaacgtaatgatatagattttcaacggggacgttttcgtgta
agaggcgatgttgttgaaatctttccggcttcacgtgctgaacgtgctttaagagttgaa
ttttttggtgatgaaatcgatcgaatacgtgaagttgatgcgttaacgggtgaaatatta
aatgaaacagagcatgtttctattttcccggcgactcactttgtgacagatgaagatcat
atggaaactgctattgcttcgattaagcaggaattagatactcgtttagcaattttaaaa
gaaaataataaattattagaagcacaacgattagaacaaagaacgaattatgatattgaa
atgttgcgagaaatgggctatacttcaggcattgaaaactactctagacatatggacgga
agagaagaaggagagcccccgtatacactattagactttttccctgaggactttttaata
gtgatcgatgaatctcacgtaactatgccgcaaattcgcgggatgtataatggagaccgg
gccagaaaacagatgctggttgactatggttttcgtttaccttcagccttagacaaccga
ccattaaggttagaagaattcgaaaaacatgtgaatcagattatttatgtttctgcgaca
ccaggtccttacgaatacgaccagacagatacggtggttgaacaaatcattcgtccaact
ggtttattggatccagtgattgatgtccgtcctattatgggacagatcgatgatcttgta
ggggaaatcaatgaacgtgtggaaagagacgagcgtgtttttgttacaactttaactaaa
aaaatggcggaagatttaaccgactatttccgagaattaggaataaaagtcaagtacctt
cacagtgatattaaaacattagaacgaacagaaattatccgcaacttgcgattaggtgag
tttgatgttttagtaggaattaacttactaagagaaggtttagatgtgcctgaagtttct
cttgtcgcgatattagacgctgataaagaaggctttttgcgtagcgaacgttcccttgta
caaacgatgggaagagcggctagaaacgctgatggtgaggttgtgatgtatgctgataaa
gtgactgattctatgcaaaatgctatagatgaaaccactcgtcgtcgtaaaattcaagaa
gcatacaatgaagaacacgggattgttccacaaacagttaaaaaagatgttcgagattta
atttcaatttcttctgttaccgaagaaggcgaagaaaaacaagtctcttacgaagatctt
acaaaagatgaaaaagaagatttaattgaaaaattaaatacagaaatgaaagaagctgct
aaatcgcagaattttgaaaaagcagctaatttacgtgattcgattttagaattaaaagct
taa

DBGET integrated database retrieval system