KEGG   Tetragenococcus halophilus NBRC 12172: TEH_13490
Entry
TEH_13490         CDS       T01640                                 

Gene name
ponA
Definition
(GenBank) penicillin-binding protein 1a
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
thl  Tetragenococcus halophilus NBRC 12172
Pathway
thl00550  Peptidoglycan biosynthesis
thl01100  Metabolic pathways
thl01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:thl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    TEH_13490 (ponA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    TEH_13490 (ponA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:thl01003]
    TEH_13490 (ponA)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:thl01011]
    TEH_13490 (ponA)
Enzymes [BR:thl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     TEH_13490 (ponA)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     TEH_13490 (ponA)
Glycosyltransferases [BR:thl01003]
 Polysaccharide
  Bacterial polysaccharide (excluding LPS)
   TEH_13490 (ponA)
Peptidoglycan biosynthesis and degradation proteins [BR:thl01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   TEH_13490 (ponA)
SSDB
Motif
Pfam: Transgly Transpeptidase SRP1_TIP1 SLC12
Other DBs
NCBI-GeneID: 11260959
NCBI-ProteinID: BAK94676
UniProt: G4L802
LinkDB
Position
complement(1352219..1354669)
AA seq 816 aa
MANQSDSRVSRHKQDKPKKRGVGSILLKIIISLFIFACIVLVAGAGLFMFYAKDAPELSE
DELDATVSSKLYAANGEIFQDIGSEKREEISPTDVPQQLEDAIVSIEDRRFYKHIGVDPI
RIAGSAFSNVTTGGKQGGSTLTQQLIKLSYFSTSEKDQTLKRKAQEAWLAVKLERQKSKQ
EILTYYINKVYMSNGLYGMQTAAESFYGKPLEELSLAQTAMIAGMPNAPNYYDPYEHQEE
AKERRDTVLYTMLDNDKITQQEYDDASNTPIDDDLQELEEDDDDGKYYDNYTKEVIKEVE
DKTGKDVYRDGLNIYTNLDEDAQKHLYDIVNSDEYVDYPDEKMQVASTLIEPDTGQVKAQ
IGGRNVKEGTVLGNNLAVNTSRDFGSTVKPIVDYGPAFEFKKYSTAKTIVDEPYSYEGSD
TQINNWDNSFMGSMTLRKALVLSRNIPAAKLFADVGTDSIQGFLENLGIQYKNLNQSNAI
SSNADEQDGANYGISSLKMAAAYGALANGGTYYEPQYVNKIVYQDGSEETDAFEVEGQKA
MEDTTAYMVTDILKDVITDADGTGTNAAISGLYQAGKTGTSNYTDEELEKLEGNPSSPSP
DSNFVGYTRNYSLAVWTGYNDKMTPVTSESSHVASDVYRELMEYVSSSVENNDWTMPDGL
VRIGKELYLKGQDDTASTSRRTRRSAPSSSSTPSSQRSSQTSEEPSTETEEESNTETEPT
SEPEESSSTTEEEEETTETEEEPSQEEEESSEPSSEPEEEPSSSEEEEPPEEEPDTSEPD
EGNNDDGGSSEENGGGNEEESPPDTGDDGNQEESSE
NT seq 2451 nt   +upstreamnt  +downstreamnt
atggcaaatcaatcagattcacgagtcagtcgacataagcaagataaacccaaaaagcgc
ggtgtcggctctattttacttaaaattattatttctttgtttatctttgcttgtatcgtt
ttagttgctggagccggtctgtttatgttttatgcaaaagacgcacctgagctgagcgaa
gacgagctagatgcaaccgtctcttccaaactgtatgctgcaaatggagagattttccag
gatatcggttcagaaaaacgtgaagaaatttccccgaccgatgttccccaacaattagaa
gatgcgattgtatcaattgaagatcgtcgtttttataaacatatcggggtcgatccaata
aggattgcaggttccgctttttctaatgtcactacaggaggaaaacaaggaggaagtact
ttaacccaacagctgatcaaactttcctatttttctaccagcgaaaaagatcaaacgcta
aaacgtaaagctcaagaagcttggttagcagttaaattagaacggcaaaaatctaagcaa
gaaattttaacttattatatcaataaagtgtacatgtcaaacggcctttatggtatgcaa
acagcagcagagtccttttatggcaagcctttggaggaactatcgcttgcgcaaactgcg
atgattgctggcatgccaaatgcgcccaattattatgacccttatgaacatcaagaagaa
gcaaaagagcgacgtgatactgttttatatacaatgttagataatgacaaaatcacgcaa
caagaatatgatgatgccagtaatacaccaattgatgatgatctgcaagaactagaagaa
gacgatgatgacgggaagtattatgacaattatacaaaagaagtcatcaaagaagttgaa
gataaaaccggaaaagatgtatatcgagatggacttaatatttatacaaatttggatgag
gatgcgcaaaaacatctatacgatattgtaaactctgatgaatatgttgattaccctgat
gagaaaatgcaagtagcttctacactgattgagccagatactggccaggttaaagcacaa
atcggtggcagaaatgttaaagaaggaacggttttaggcaacaacttagctgttaatacc
tcaagagatttcggttccacggtaaaaccaatagttgactatgggccagcttttgaattt
aaaaaatattcaacagctaaaacgattgttgatgaaccttattcttatgaaggtagtgat
acccaaattaataattgggataactcttttatgggctctatgacgctacgtaaagccctt
gtactttcaagaaatatccctgcagctaaactttttgcagacgtaggcaccgattcgatt
caaggatttttggaaaatctgggaatccaatataaaaatttaaaccaatcaaatgctata
tcaagcaacgctgatgaacaagatggtgctaattatggtatatctagtctgaaaatggcg
gctgcttatggcgctcttgctaacggtggaacatattatgaaccgcaatatgttaataaa
atcgtttatcaagacggctctgaagaaacagacgcttttgaagttgaaggtcaaaaagct
atggaagatacaacagcttacatggtcaccgacatcttaaaagacgttattacagacgct
gatggtacaggaacgaatgccgcaatttccggtttataccaagccggtaaaaccggaact
tctaattacacagatgaagaattggaaaagcttgagggtaatccatcctctccttcacca
gattctaactttgttggttatactagaaattattcgttagctgtatggacaggttataat
gataaaatgacgcctgtaactagcgaatcttctcatgtagcctctgatgtttatcgtgaa
ttaatggaatatgtatcttcttcggtcgaaaataacgattggacaatgcctgatggttta
gttcgtattggaaaagaactttacttaaaaggacaagatgatacagcttcaacttcaaga
aggacaaggcgaagtgcaccatcatcttcttctactccttcttcacaaagatcatcacag
acatcagaagagccttcgacggagacagaagaagaaagtaatacagaaacagaaccaact
agcgaaccagaagaaagttcttcaacaactgaagaagaggaagaaacaacggaaacagaa
gaagaaccctctcaagaggaagaagaaagttcagaaccaagtagcgaaccagaagaagaa
ccttcatcatcagaagaagaggagccacctgaagaggaaccagatactagtgaacctgat
gaaggaaacaacgatgatggaggaagtagtgaagaaaacggaggcggaaacgaagaagaa
agtccacctgatacaggtgatgatgggaatcaagaggagtcttcggaataa

DBGET integrated database retrieval system