KEGG   Tetragenococcus halophilus NBRC 12172: TEH_25150
Entry
TEH_25150         CDS       T01640                                 

Gene name
rpe
Definition
(GenBank) ribulose-5-phosphate 3-epimerase
  KO
K01783  ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
thl  Tetragenococcus halophilus NBRC 12172
Pathway
thl00030  Pentose phosphate pathway
thl00040  Pentose and glucuronate interconversions
thl01100  Metabolic pathways
thl01110  Biosynthesis of secondary metabolites
thl01120  Microbial metabolism in diverse environments
thl01200  Carbon metabolism
thl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:thl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TEH_25150 (rpe)
   00040 Pentose and glucuronate interconversions
    TEH_25150 (rpe)
Enzymes [BR:thl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.1  ribulose-phosphate 3-epimerase
     TEH_25150 (rpe)
SSDB
Motif
Pfam: Ribul_P_3_epim QRPTase_C OMPdecase NanE Spherulin4
Other DBs
NCBI-GeneID: 11261503
NCBI-ProteinID: BAK95842
UniProt: G4L4W9
LinkDB
Position
complement(2520794..2521444)
AA seq 216 aa
MKISPSILSADFANLQRDIELVEENGADYIHVDVMDGHFVPNITFGPDAIKAIRPVTKLP
LDTHLMIENPESYIDDFAEAGADIIGVHAEATAHIHRALQMIKNKNVQAEVVINPGTSVD
SIYHVLSMVDQILVMTVNPGFGGQSFIEETLYKIEQLAKLKAENGYKYDIEVDGGIVPET
AKQCKEAGANVFVAGSYIYSAEQPKKQIQLLKEAVE
NT seq 651 nt   +upstreamnt  +downstreamnt
atgaaaatttcaccatctattttaagcgctgattttgcaaatttacaacgggatattgaa
ctagtagaggaaaatggtgcagattatattcatgtagatgtcatggatggacactttgta
cctaatattacatttggcccagatgcgatcaaagcgattcgacctgtaactaaattacca
ttagatacgcatttaatgattgaaaatccggaaagttatatagatgactttgctgaggca
ggagctgatatcattggtgtgcatgctgaagcgacagcccatattcatcgcgcgttacaa
atgataaaaaataaaaatgttcaagcagaagtggttatcaatcctggcacatctgttgat
tctatttatcatgtgttatctatggtggatcaaatacttgttatgacagttaacccgggt
tttggcggtcaatcttttattgaagaaacactttacaaaattgagcaattagctaagtta
aaggctgaaaacggttataaatacgatatagaagtcgatggtggaattgttcctgagact
gcaaagcaatgtaaagaagcaggcgcaaatgtctttgttgctggtagttatatttacagt
gcagaacaacctaaaaaacaaattcaacttttgaaagaagcggttgaataa

DBGET integrated database retrieval system