KEGG   Thermosynechococcus sp. NK55: NK55_00070Help
Entry
NK55_00070        CDS       T02977                                 

Gene name
gatA
Definition
(GenBank) aspartyl-tRNA / glutamyl-tRNA amidotransferase subunit A GatA
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
thn  Thermosynechococcus sp. NK55
Pathway
thn00970  Aminoacyl-tRNA biosynthesis
thn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thn00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    NK55_00070 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:thn03029]
    NK55_00070 (gatA)
Enzymes [BR:thn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     NK55_00070 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     NK55_00070 (gatA)
Mitochondrial biogenesis [BR:thn03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    NK55_00070 (gatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AHB87407
UniProt: V5V3H8
LinkDB All DBs
Position
complement(14834..16282)
Genome map
AA seq 482 aa AA seqDB search
MSVIQELHRQLVRKERSATEITQAYLDRIDQVEPTLHSFLTVTRDRALAQAAEVDKRLAA
GEEIGLLTGIPLAIKDNLCTYGVRTTCASKMLEHFVPPYESTVTEKLQAAGAIMVGKTNL
DEFAMGSSTENSAFGFTANPWNPQRVSGGSSGGSAAAVAAGECAAALGSDTGGSIRQPAA
FCGVVGLKPTYGLVSRYGLVAYASSLDQVGPLAPTVTDAAILLGAIAGHDAKDATSLSVP
IPDYTQALKPDLKGMRIGLIQETVDEGVQPEVKSALEAALKTLEELGATIVELSCPRFAY
GLPTYYIIAPSEASANLARYDGVNFGFRAEGAADLLEMYMKTRAQGFGPEVKRRIMIGTY
ALSAGYYDAYYLRAQKVRTLIKEDFARAFEQVDLLVCPTAPTTAFKAGEKTTDPLSMYLS
DLMTIPVNLAGLPGLSLPCGFDREGLPIGLQLIGNVLGEETLFHVAYAYEQATPWHRQQP
QL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtgattcaggagctacaccgtcaactcgttcgcaaagagcgctccgccactgaa
attacccaggcctatttggatcgcattgatcaagtagaaccaacactccacagctttttg
acggtaacgcgcgatcgcgcccttgcccaagctgccgaggtggataaacgccttgctgcg
ggtgaagaaattggtttgctcacaggaattcccctggccatcaaggataacctttgcacc
tacggcgttcgcaccacctgtgcttctaagatgctggagcactttgtacccccctacgaa
tccaccgtaaccgaaaaattgcaggccgctggcgcgattatggtgggcaaaaccaacctt
gatgaatttgccatgggcagctccacggaaaattccgcctttggtttcacggccaatcct
tggaacccgcagcgggtttctggcggctcctcagggggatccgctgcagccgttgctgcc
ggggaatgtgccgctgctctgggctccgatactggtgggtccattcgtcaacccgccgcc
ttctgcggagtagtgggtctcaagcccacctatggtttggtgtcccgctatggtctggtt
gcctatgcctcctccctcgatcaagtgggtcccttagcgccgacggtgactgatgcagct
attctcttgggggcgatcgccggccacgatgccaaggatgccaccagtctcagcgtgccg
attcccgactacacccaagccctcaagcctgatctcaaaggcatgcgcattggccttatt
caagaaaccgtggatgaaggcgtgcaaccggaggtgaagtccgcccttgaagccgcccta
aaaaccctagaggaattgggggcaaccattgttgaactctcctgtccccgctttgcctac
ggcctgcccacctactacatcattgccccttcagaagcctcggcgaacttagcccgctat
gatggcgtgaactttggttttcgggctgaaggggccgctgatctgcttgagatgtacatg
aaaacccgcgctcaaggctttggccccgaagtaaagcgacggattatgattggcacctac
gccctgtctgccggctactacgatgcctactacctacgagcccaaaaagtacgcaccctg
atcaaagaagactttgcccgtgcctttgaacaagtggatctcctggtttgccccaccgct
cccaccactgcttttaaggcaggggagaaaaccaccgaccccctaagtatgtacctgtca
gacttgatgaccatccctgtaaaccttgcgggcttacccggcctgagcctcccctgcggc
tttgatagggaagggctgcccattggcctgcaattgattggcaacgtcctaggcgaagag
accctatttcacgttgcctatgcctatgaacaggccaccccttggcatcggcagcagccg
cagctctag

DBGET integrated database retrieval system