KEGG   Thermosynechococcus sp. NK55: NK55_02635Help
Entry
NK55_02635        CDS       T02977                                 

Definition
(GenBank) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
thn  Thermosynechococcus sp. NK55
Pathway
thn00040  Pentose and glucuronate interconversions
thn00051  Fructose and mannose metabolism
thn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NK55_02635
   00051 Fructose and mannose metabolism
    NK55_02635
Enzymes [BR:thn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     NK55_02635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 CoA_binding 2-Hacid_dh_C Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: AHB87883
UniProt: V5V3A0
LinkDB All DBs
Position
550735..551877
Genome map
AA seq 380 aa AA seqDB search
MREVKKRYHQDLLSAQGTIIFRGDEFAKVSMKAQVFRGVNQLSYEEIPIPEIAADEVLVR
VRVVGLCQSDIKKIRYPLYEPPRIFGHETVGEIAAVGDAVTGWQVGQRVVVMHHIPCMRC
AYCLNENYSMCHVYKTVTTTAGFIPSGGGFAEYVKVPGHIVQHGGLIPIPDHISDEEASF
IEPTNCCLKAVKKAAIAPGQTVLITGVGPIGLMFIMLVNLFGARAIATDLLPSRIAKAKE
VGAAAAFDARDPDLSAKVQALTQGLGVDVSLLAVPSEKAFCQALECTRKGGKILFFAEFP
DEVEIPLNPNILYRREIDLMGSYSSSYRLQSLACDIIFNRRIDVKTLVSDRYPLAQLAEA
VERAVHPTPETYKILIYPES
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
ttgcgtgaagtcaaaaagcgatatcatcaagacttgctctcagcgcaagggacaattatc
tttaggggtgacgagtttgcaaaggtctcaatgaaagcccaagtgttccgaggggtaaat
caactcagctacgaagagattccgattcctgaaattgctgctgatgaagtattagtgcgg
gtcagggtggttgggttgtgccaatcggacatcaagaaaattcgctatcccctctatgag
ccgccccgtatttttggccatgaaacagtgggtgaaattgccgcggtgggcgatgcggtg
acgggttggcaagtgggtcagcgggtggtggtcatgcaccacatcccctgtatgcgctgc
gcctactgtttgaacgaaaactactccatgtgtcatgtttataaaacagtaacgacaacg
gcaggctttattcccagtggtggtggcttcgctgagtatgtgaaagtgccgggacacatc
gtgcagcatgggggactgattcccattcccgatcatattagcgatgaggaagccagcttc
attgaacccaccaactgttgtctcaaggcagtgaagaaagcggcgatcgctcccggtcaa
acggtgttgattacgggagtagggcctattggtctgatgttcattatgttggtgaatctc
tttggagcgcgggcgatcgccaccgatctcctaccctcgcggattgctaaagccaaagaa
gtgggggctgctgctgcctttgatgcccgcgatccggatctgagtgccaaggtgcaggcc
ctgacccaaggcttgggggtagatgtcagtctcttggcggtccccagtgaaaaagccttt
tgccaagccctagagtgtacgcgcaaggggggcaaaatcctgttttttgcggagtttccc
gatgaagtggagattcccctcaatcccaacattctctaccgccgtgagattgacctcatg
gggagctacagttcctcctatcgcttgcagtcccttgcctgcgacatcatctttaaccgc
cgtattgacgtcaaaaccctcgtcagcgatcgctatcccttggctcaactagctgaggca
gtggaacgggcagtgcatcccaccccggaaacttacaaaatcctcatctatccagagtcc
taa

DBGET integrated database retrieval system