KEGG   Thermosynechococcus sp. NK55: NK55_03260Help
Entry
NK55_03260        CDS       T02977                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase dihydrolipoamide acetyltransferase E2 component PdhC
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
thn  Thermosynechococcus sp. NK55
Pathway
thn00010  Glycolysis / Gluconeogenesis
thn00020  Citrate cycle (TCA cycle)
thn00620  Pyruvate metabolism
thn01100  Metabolic pathways
thn01110  Biosynthesis of secondary metabolites
thn01120  Microbial metabolism in diverse environments
thn01130  Biosynthesis of antibiotics
thn01200  Carbon metabolism
Module
thn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:thn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NK55_03260 (pdhC)
   00020 Citrate cycle (TCA cycle)
    NK55_03260 (pdhC)
   00620 Pyruvate metabolism
    NK55_03260 (pdhC)
Enzymes [BR:thn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     NK55_03260 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl AATase ATP-grasp MadL
Motif
Other DBs
NCBI-ProteinID: AHB87998
UniProt: V5V3N5
LinkDB All DBs
Position
690744..691988
Genome map
AA seq 414 aa AA seqDB search
MIRELFMPALSSTMTEGKIVSWLKSPGDKVAKGETVLIVESDKADMDVESFYDGYLAVIT
VPAGEVAAVGSTIGLVAETEAEIAEAEAKAKSLGKATSSDRAPATSNGSGTAPAASAAAV
PAGRVIASPRARKLAKEHKIDLKTLKGTGPNGRITAADVEALIGAPAPPPVATSPAPLPT
APPATAPVVAKEDLVPLTTLQNAVVRNMVASLGIPDFHVAYTITTDALDRLYQQIKSKGV
TMTVLLAKAIALTLQKHPIMNAYYTEQGIQYRRDINIAVAVAMPGGGLITPVLKNADQID
IYSLSRTWKDLVERARAKQLQPDEYSTGTFSLSNLGMFGVDFFDAILTPGQGAIMAVGAS
RPTVVATEDGLLGVKRQMKVNITCDHRVIYGADAAAFLQDLAKLIETNPQALTL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgattcgtgaactgttcatgcccgccctcagctccaccatgaccgaagggaaaattgtc
tcttggctgaaatctcccggggataaggtggctaaaggggaaaccgtgctgattgtggaa
tccgacaaggccgatatggatgtggagtccttctacgacggctatttggcagtgattacc
gtacctgctggcgaagtagcagccgttggctccaccattggccttgtggcagaaacagaa
gcagaaattgcggaagcagaggcaaaggccaagtcccttgggaaggctaccagttctgac
cgggctccagccacgagtaatggctcaggaacggctcctgccgccagtgctgccgctgta
ccggctgggcgagtgattgcctccccccgtgcccgcaaattggccaaggaacacaaaatt
gatttgaagacgctcaagggaactggccccaatggtcggattacagccgccgatgtggaa
gctttgattggtgcgcctgcacccccccccgtggcaacgtcccctgcccctctccccacc
gccccccctgctactgctccggtggtggctaaggaggatttggtgcccctgacaacgctg
caaaatgccgttgtgcgcaatatggtggccagcctgggcattcccgatttccacgtcgcc
tacacgatcacaaccgatgccttggatcggctgtatcagcaaattaagtccaaaggggtg
acaatgacggtgctccttgccaaggcgatcgccctgacattgcaaaaacacccaattatg
aatgcctactacacagagcaggggattcaataccgtcgtgatattaacattgctgttgcg
gtggcgatgccggggggtggtctgattacaccggtgctaaagaacgccgatcaaattgac
atctacagcctctcgcgtacttggaaagacttggtggaacgggcacgcgccaagcaactg
caacccgatgagtacagcacgggcacctttagcctctcgaacctcggcatgtttggagtt
gacttctttgatgccattctcacgcccggtcaaggggcgattatggcggtgggggcgtcg
cgtccgacggtagttgccacagaggatggcctgctgggggtaaaacggcagatgaaggtg
aatattacctgtgatcaccgggtgatctatggtgctgatgcagctgccttccttcaggat
ttggcaaaactgattgaaactaatccccaagcattgacgctctaa

DBGET integrated database retrieval system