KEGG   Thermosynechococcus sp. NK55: NK55_03260
Entry
NK55_03260        CDS       T02977                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase dihydrolipoamide acetyltransferase E2 component PdhC
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
thn  Thermosynechococcus sp. NK55
Pathway
thn00010  Glycolysis / Gluconeogenesis
thn00020  Citrate cycle (TCA cycle)
thn00620  Pyruvate metabolism
thn01100  Metabolic pathways
thn01110  Biosynthesis of secondary metabolites
thn01120  Microbial metabolism in diverse environments
thn01200  Carbon metabolism
Module
thn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:thn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NK55_03260 (pdhC)
   00020 Citrate cycle (TCA cycle)
    NK55_03260 (pdhC)
   00620 Pyruvate metabolism
    NK55_03260 (pdhC)
Enzymes [BR:thn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     NK55_03260 (pdhC)
SSDB
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl ATP-grasp MadL
Other DBs
NCBI-ProteinID: AHB87998
UniProt: V5V3N5
LinkDB
Position
690744..691988
AA seq 414 aa
MIRELFMPALSSTMTEGKIVSWLKSPGDKVAKGETVLIVESDKADMDVESFYDGYLAVIT
VPAGEVAAVGSTIGLVAETEAEIAEAEAKAKSLGKATSSDRAPATSNGSGTAPAASAAAV
PAGRVIASPRARKLAKEHKIDLKTLKGTGPNGRITAADVEALIGAPAPPPVATSPAPLPT
APPATAPVVAKEDLVPLTTLQNAVVRNMVASLGIPDFHVAYTITTDALDRLYQQIKSKGV
TMTVLLAKAIALTLQKHPIMNAYYTEQGIQYRRDINIAVAVAMPGGGLITPVLKNADQID
IYSLSRTWKDLVERARAKQLQPDEYSTGTFSLSNLGMFGVDFFDAILTPGQGAIMAVGAS
RPTVVATEDGLLGVKRQMKVNITCDHRVIYGADAAAFLQDLAKLIETNPQALTL
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgattcgtgaactgttcatgcccgccctcagctccaccatgaccgaagggaaaattgtc
tcttggctgaaatctcccggggataaggtggctaaaggggaaaccgtgctgattgtggaa
tccgacaaggccgatatggatgtggagtccttctacgacggctatttggcagtgattacc
gtacctgctggcgaagtagcagccgttggctccaccattggccttgtggcagaaacagaa
gcagaaattgcggaagcagaggcaaaggccaagtcccttgggaaggctaccagttctgac
cgggctccagccacgagtaatggctcaggaacggctcctgccgccagtgctgccgctgta
ccggctgggcgagtgattgcctccccccgtgcccgcaaattggccaaggaacacaaaatt
gatttgaagacgctcaagggaactggccccaatggtcggattacagccgccgatgtggaa
gctttgattggtgcgcctgcacccccccccgtggcaacgtcccctgcccctctccccacc
gccccccctgctactgctccggtggtggctaaggaggatttggtgcccctgacaacgctg
caaaatgccgttgtgcgcaatatggtggccagcctgggcattcccgatttccacgtcgcc
tacacgatcacaaccgatgccttggatcggctgtatcagcaaattaagtccaaaggggtg
acaatgacggtgctccttgccaaggcgatcgccctgacattgcaaaaacacccaattatg
aatgcctactacacagagcaggggattcaataccgtcgtgatattaacattgctgttgcg
gtggcgatgccggggggtggtctgattacaccggtgctaaagaacgccgatcaaattgac
atctacagcctctcgcgtacttggaaagacttggtggaacgggcacgcgccaagcaactg
caacccgatgagtacagcacgggcacctttagcctctcgaacctcggcatgtttggagtt
gacttctttgatgccattctcacgcccggtcaaggggcgattatggcggtgggggcgtcg
cgtccgacggtagttgccacagaggatggcctgctgggggtaaaacggcagatgaaggtg
aatattacctgtgatcaccgggtgatctatggtgctgatgcagctgccttccttcaggat
ttggcaaaactgattgaaactaatccccaagcattgacgctctaa

DBGET integrated database retrieval system