KEGG   Thermosynechococcus sp. NK55: NK55_04225Help
Entry
NK55_04225        CDS       T02977                                 

Gene name
sodB-1
Definition
(GenBank) Mn-superoxide dismutase SodB
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
thn  Thermosynechococcus sp. NK55
Brite
Enzymes [BR:thn01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     NK55_04225 (sodB-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AHB88172
UniProt: V5V5R4
LinkDB All DBs
Position
complement(907899..908501)
Genome map
AA seq 200 aa AA seqDB search
MAFVQEPLPFDPGALEPYGMSAKTLEFHYGKHHKGYLDNLNKLTQDTELADKSLEDVIRM
TYGDAAKVGIFNNAAQVWNHTFFWNSLKPGGGGTPTGDVAARINSAFGSYDEFKSQFKNA
AATQFGSGWAWLVLEAGTLKVTKTPNAENPLVHGQVPLLTIDVWEHAYYLDYQNRRPDFI
DNFLNQLVNWDFVAKNLAAA
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgtacaagaaccccttccctttgatccgggtgcccttgaaccctatggaatg
tctgcaaaaacccttgaatttcactatggcaaacaccataaaggctacctggataacctc
aataaactgactcaagatacggaactcgctgacaaatcccttgaagatgtcattcgcatg
acctatggcgatgctgccaaagtgggcatcttcaacaatgccgctcaagtgtggaatcac
accttcttctggaatagcctcaagccaggtggcggcggtactcctacgggtgatgtggct
gctcggatcaacagtgcttttggtagctacgacgaattcaagtcccagttcaaaaatgcc
gcagcgacccaatttggcagcggttgggcatggctggtgcttgaagctggcacactgaaa
gtgactaaaacgcccaatgccgaaaaccccttggttcacggtcaagtgcccctactgacg
attgatgtttgggagcacgcctactatctcgactaccaaaaccgtcgtcccgacttcatt
gataacttcctgaaccaactggtgaactgggattttgttgctaagaacttggcagctgcc
taa

DBGET integrated database retrieval system