KEGG   Thermosynechococcus sp. NK55: NK55_11620Help
Entry
NK55_11620        CDS       T02977                                 

Gene name
dldA
Definition
(GenBank) D-alanine--D-alanine ligase DdlA
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
thn  Thermosynechococcus sp. NK55
Pathway
thn00473  D-Alanine metabolism
thn00550  Peptidoglycan biosynthesis
thn01100  Metabolic pathways
thn01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:thn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    NK55_11620 (dldA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NK55_11620 (dldA)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    NK55_11620 (dldA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:thn01011]
    NK55_11620 (dldA)
Enzymes [BR:thn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     NK55_11620 (dldA)
Peptidoglycan biosynthesis and degradation proteins [BR:thn01011]
 Precursor biosynthesis
  Amino acid ligase
   NK55_11620 (dldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AHB89561
UniProt: V5V878
LinkDB All DBs
Position
complement(2435468..2436499)
Genome map
AA seq 343 aa AA seqDB search
MGRLRVGLLFGGRSREHEVSVVSAAAIAQAFAAGDNHDRYEVIPIYIQKDGRWRHTERIG
IPEGTASESSLWQFPAVVDTIDVWFPIVHGPNGEDGTIQGLLELMQRPYVGSGVAASAIG
MDKILMKTVFGAIGLPQVRYVALQRSDLWSDPCRYNHLCDRIETELGYPCFVKPANLGSS
VGISKAKNRQQLTTALEAAAELDRRIIVEAAVVARELECAVLGNDKLQASVVGEITYSSE
FYDYETKYTDGRAQLHIPAEIPPAVSEQIRSMSLQAFQALDAAGLARFDFFYVPSTGEVL
INEVNTLPGFTALSMYPQLWAASGVSFPELVHRLVQLALERHA
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgtctgcgggttgggctattgtttggaggtcgctcacgggagcatgaagtttcg
gtagtctcggcggcagcgatcgcccaagcctttgccgcgggggacaatcacgatcgctat
gaggtgattcccatctacatccaaaaagatggtcgctggcggcacacagagcggattggc
atccctgaaggcacggcatcagagagttccctgtggcagtttccagccgtggttgacacc
attgatgtctggtttcccattgtccatggccccaatggggaagatggaacgattcaggga
ctcttggaattgatgcagcgcccctatgtggggtcaggggtagctgcctctgccattggt
atggacaaaattctgatgaaaacagtctttggggcaatcggcttaccccaagtgcgctat
gtggcacttcagcgcagtgacctgtggtcagatccctgtcgttacaatcatttgtgcgat
cgcattgaaaccgaattgggctatccctgctttgttaagcccgccaaccttggctcctcg
gtgggcatctccaaagccaaaaatcgccaacaactgacaacggcccttgaggccgctgcc
gaactggatcgccgcattattgtggaagcggctgtggttgcccgtgagctcgagtgtgct
gtgctcggcaatgataaactccaagcctcagtggtgggggagattacctacagcagtgag
ttttacgactacgaaaccaaatacaccgatggccgcgctcagctccatatccctgcggag
attcccccggcggtgagtgagcaaattcgcagcatgtccctgcaagcctttcaggccctc
gatgccgctggcttagctcgctttgattttttctatgtaccaagcactggggaagtcttg
atcaatgaagtgaatacgctgccggggtttaccgccctgagcatgtacccgcaactgtgg
gcggccagtggcgtgtctttcccagaattggtccatcgtttggtgcaattggccctagag
cggcacgcatag

DBGET integrated database retrieval system