KEGG   Candidatus Thioglobus autotrophicus: SP60_05905Help
Entry
SP60_05905        CDS       T04079                                 

Definition
(GenBank) peptidoglycan glycosyltransferase
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
tho  Candidatus Thioglobus autotrophicus
Pathway
tho00550  Peptidoglycan biosynthesis
tho01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:tho00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SP60_05905
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    SP60_05905
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tho01011]
    SP60_05905
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tho03036]
    SP60_05905
Enzymes [BR:tho01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     SP60_05905
Peptidoglycan biosynthesis and degradation proteins [BR:tho01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   SP60_05905
Chromosome and associated proteins [BR:tho03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    SP60_05905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: ALE52777
UniProt: A0A0M4NXJ8
LinkDB All DBs
Position
complement(1088081..1089970)
Genome map
AA seq 629 aa AA seqDB search
MKIPFLKKFPGLEKVQGYWRRQGFVKFIFTALFAIFSYQAISISNTHKPGLSVQERAHNQ
ANKLQTNTARRGDILDRNGNILASSRLLKRVILDPMLIDPAFIPGLAQALNMNEEKLSTL
LAKKRAIKSRYLPIKKNITLTDPILENLIAFKKQRVRVCIKKPGHAKISLTDKILNAINW
QSVTGEKIMINRCSKKRIGQAVVLRQDTQRYYPKSASMAPLLGRVNSENKGGSGIEAEFE
NVLAGVDGKNHLNFLKKSSKAYFNPQVTAQLLHGQNIELTIDTDIQYHAYAAIKKSVLKH
EANSGSAIILSPNGEVLAMVNYPADDPNDKSLYNPSHYRNRVLSDKVEPGSTMKPFTMLL
ALDQGKISAEDGELIDVSKSIGHLKTNREVRKYGDAITVKKILQKSHNLGTVNVSERLSK
EAMYNTWNKLGFSHPLGLIPSIENSGSLRHYSSWGMMDKRTLSFGYGPMNTNLAQLARAY
LVFANQGAMPSLKLIKNMVYNEEKVQIFNKKSTDKIAELLDSVASNDGSGYWSSIKGYSI
AGKTGTAEMSINGSYDKNGAQRTFFAGFVPVKKPKYIMLVRLDHPKKCYSKGKKKLKRNC
QGSNSAAIVFNETMKHILTNDKSIKMSLR
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcccttttctaaaaaaatttcccggccttgaaaaagttcaaggatattggcgt
cgacaggggtttgtaaaatttatatttaccgctttatttgctattttttcttatcaagct
atttccatttccaatacccataaacctggattatctgtgcaagaacgcgcgcacaaccaa
gccaacaaactacaaaccaacaccgctagacgcggggatattctagatcgaaatggcaac
atattggccagctctagactgctaaaacgggtgatattagatcccatgctgattgatcca
gcttttatccctggcttggcacaagcactcaatatgaatgaggaaaaactcagcacactg
cttgctaaaaaaagagcgataaaatcacgctacctaccgattaagaaaaacatcaccctc
accgaccctattcttgaaaacctgattgcttttaaaaaacaaagagtacgagtatgcatt
aaaaaaccaggtcatgccaaaatcagcttaaccgataaaatactgaacgctattaattgg
caatcggtaacgggtgaaaaaataatgattaaccgttgctcaaaaaagagaattggacag
gcagttgttttaagacaagacacgcaaagatactatcctaagtctgcttccatggcacct
ctgttgggtcgtgttaattcagaaaataaaggtggatcaggcatcgaggcagagtttgaa
aatgttctggctggtgtagatggtaaaaaccatttaaactttttaaaaaagagcagtaag
gcttatttcaatccacaggtgacggctcagctattacatgggcaaaatatcgagctaaca
attgataccgatatccaataccatgcttatgcagcgattaaaaaatcggttttaaaacat
gaggctaactcaggatcggccattattctatcgcctaatggcgaggtgttagccatggtc
aactaccctgctgatgaccctaatgataagagtttgtacaatccgagtcattatcgtaat
cgcgtattatctgacaaagtagagccaggctctactatgaaacccttcaccatgcttttg
gcacttgaccagggcaaaattagcgcagaagatggtgagctgattgatgtcagcaagtca
atcgggcaccttaaaaccaatcgggaagtaaggaaatatggtgacgctattactgtgaaa
aagatcctgcaaaaatctcataacttaggcactgttaacgtctctgagcgtcttagcaaa
gaagccatgtataacacttggaataagcttggatttagccatcctctgggcttaattcca
agtattgaaaattcaggatcgcttaggcattattcatcgtggggaatgatggacaagcgt
acactttccttcggatacggccccatgaataccaacctagctcagcttgctagagcctac
cttgtctttgccaatcagggtgcaatgcccagtttaaagctgattaaaaacatggtttat
aatgaagaaaaagtgcaaatttttaataaaaaatcaactgataaaatagcagaattacta
gacagtgttgcctctaatgatggctctggctattggtcaagtattaagggctatagtatt
gcgggaaaaaccggtactgcagagatgagtatcaacggctcttatgataaaaatggcgct
cagcgtaccttctttgcaggctttgtaccagttaaaaaaccgaaatatattatgctggtg
aggttagatcaccctaaaaaatgctattcaaagggtaagaaaaaattgaaaagaaattgt
caaggatccaactcagctgccattgtttttaacgaaaccatgaaacacattctaaccaat
gacaagtcaattaaaatgagtctaagataa

DBGET integrated database retrieval system