KEGG   Candidatus Thioglobus autotrophicus: SP60_05960Help
Entry
SP60_05960        CDS       T04079                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
tho  Candidatus Thioglobus autotrophicus
Pathway
tho00020  Citrate cycle (TCA cycle)
tho00190  Oxidative phosphorylation
tho00650  Butanoate metabolism
tho01100  Metabolic pathways
tho01110  Biosynthesis of secondary metabolites
tho01120  Microbial metabolism in diverse environments
tho01130  Biosynthesis of antibiotics
tho01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tho00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SP60_05960 (sdhA)
   00650 Butanoate metabolism
    SP60_05960 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SP60_05960 (sdhA)
Enzymes [BR:tho01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SP60_05960 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     SP60_05960 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO Pyr_redox_2 NAD_binding_8 F420_oxidored HI0933_like
Motif
Other DBs
NCBI-ProteinID: ALE52786
UniProt: A0A0M5LEM4
LinkDB All DBs
Position
1099578..1101506
Genome map
AA seq 642 aa AA seqDB search
MSNLYANEPTGPLESRWEKHLFNLSLIAPQNRKKHKIIVVGTGLAGASLCATLGEAGYQV
SSFCFQDSPRRAHSIAAQGGINATKNYQNDGDSVWRLFYDTIKGGDFRARESNVYRLAEL
SGNIIDQAVAQGVPFAREYSGYLANRSFGGTQVSRTFYARGQTGQQLLLGAYQAHSRQLE
NDNVSHQSRAEMLELIMVDDKARGVIVRDLISGEISAHTADCVILCTGGYSNAFYLSTNA
KGCNTSATWRAYKQGAYFANPSFTQIHPTCVPPTGENQSKLTLMSESLRNDGRIWAPKNI
EDCTKNPADIKEEDRDYFLERMYPAFANLVPRDVASRAVKHICDQGHGVGSKIHGQRLGV
YLDFSAIIEKLGLEAVAEKYGNLFDMYSSITGEDPYQTPMKIYPAPHYTMGGLWVDYNLM
TTIEGLFAGGEANFSDHGANRLGASALMQGLADGYFILPKTVANYLANSSLADVDDTHPQ
VVQSLKTVKDRIHQLMNAPAPKHSPEYFHQKLGKVLWEACGMSREADRLNQAIGEIAELE
SQFWQNIKVTGVDQDLNQTLERAGRVADFIELGKLMCQDALMREESCGAHARVEYLSESG
EAKRDDDDFSFVGAWEYKPEQPMLRKEQLNYEFIEPTVRNYK
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatctttatgcaaacgagccaacaggtcctttagagagtcgttgggaaaaacat
ctgttcaacttatcgttaattgcgccacaaaatcgtaaaaaacataagattattgttgtg
ggtacagggcttgcaggcgcttctctgtgtgcgacattgggtgaagccggttatcaagta
agctctttttgttttcaagattccccacgcagagcgcattctattgctgcacaaggtggt
attaatgccaccaaaaattatcaaaatgatggtgacagtgtttggcgtttattttacgac
accattaaaggtggtgattttagagcgcgcgaatctaatgtatatcgtttagctgagttg
agtggtaatattattgaccaagctgttgctcaaggcgtgccttttgccagagagtatagt
ggttatttggctaaccgttcgtttggtggaacccaagtttctcgaactttttatgcacgc
ggacaaacaggccagcagttgttacttggcgcttatcaagcgcatagtcgtcaactggaa
aatgacaacgtttctcatcagtctcgagcagaaatgttggagctaattatggttgatgat
aaagcgcgaggcgtgatagtgagagatttgatcagtggcgagatctctgcacacacagct
gattgtgttattttgtgcacaggtggctatagcaatgccttttatttatcaaccaatgcc
aaaggttgcaatacctcagcaacttggcgtgcttataagcagggcgcgtattttgccaac
ccaagctttactcaaattcacccaacttgtgtaccaccaacaggtgagaatcaatctaaa
ttgacgctaatgagtgagtctttgcgtaatgatggacgtatttgggcccctaaaaatatc
gaagattgcacaaaaaatccagcggacattaaagaagaagatagagattattttttagaa
agaatgtatccagcttttgccaatctagtgcctagagatgtagcatcacgtgcggtgaag
catatttgtgaccaaggtcatggtgtgggcagtaagattcatggccaacgtttgggtgtg
tatttagattttagcgctattattgaaaaattaggcctagaggcagtcgccgaaaagtac
ggtaatttatttgacatgtattcgagtattactggtgaagatccttatcaaaccccgatg
aagatttatccggcgccacactacaccatgggtggattgtgggtagattacaatttaatg
acaaccatagagggtttatttgccggtggtgaagctaatttttctgaccacggtgctaac
cgcctgggtgcttctgcactaatgcaagggctggcagatggctattttattctaccaaaa
acagttgctaattatttagccaatagtagcttggctgacgtagacgatacccatcctcaa
gtggtgcagagcttgaagacagtgaaagatcgcattcaccaattaatgaatgcacccgca
cctaaacactcaccagaatattttcatcaaaagttaggaaaggtattatgggaagcttgc
ggcatgtcgcgtgaagcagatcgattaaatcaagccattggtgagattgctgaattagaa
tcccagttttggcaaaatattaaagtgactggcgttgatcaagatctaaaccaaacgtta
gagcgtgcgggtcgagtggcagattttattgaattaggtaaattgatgtgtcaagatgca
ttgatgcgtgaagaatcttgtggcgctcatgcgcgagtggaatatttgtctgaaagtggt
gaagcaaaaagagatgatgacgatttttcatttgtgggcgcatgggagtataagcctgaa
caaccaatgctacgtaaagagcagcttaattacgagtttatcgaaccgactgtaaggaac
tacaaatga

DBGET integrated database retrieval system