KEGG   Candidatus Thioglobus autotrophicus: SP60_05965Help
Entry
SP60_05965        CDS       T04079                                 

Definition
(GenBank) fumarate reductase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
tho  Candidatus Thioglobus autotrophicus
Pathway
tho00020  Citrate cycle (TCA cycle)
tho00190  Oxidative phosphorylation
tho00650  Butanoate metabolism
tho01100  Metabolic pathways
tho01110  Biosynthesis of secondary metabolites
tho01120  Microbial metabolism in diverse environments
tho01130  Biosynthesis of antibiotics
tho01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tho00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SP60_05965
   00650 Butanoate metabolism
    SP60_05965
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SP60_05965
Enzymes [BR:tho01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SP60_05965
    1.3.5.4  fumarate reductase (quinol)
     SP60_05965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_7 Fer4_10 Fer4_17 Fer4_18 Fer4_9 Fer4 Fer4_2 Fer4_6 Fer4_16 Fer4_4 Fer4_21 Fer2 Fer4_3 Fer4_22 Fer4_13 Fer4_15
Motif
Other DBs
NCBI-ProteinID: ALE52787
UniProt: A0A0M4PL59
LinkDB All DBs
Position
1101503..1102234
Genome map
AA seq 243 aa AA seqDB search
MNFTLHIWRQKNGDIKGDFVTYQIDNIDEDTSFLEMLDQLNEQLIAKDQDCIVFDYDCRE
GICGACSLVINGYPHGDKKATTTCQLYMRDYKHQTELWVEPWRAESFPVIKDLTVDRTSF
DNIIQSGGYVSVHTGSAPEANALLVDKHSADEAFNSATCIGCGACVAVCPNASATLFVAA
KITHLSLLPQGKIEEQDRAQKMFNQMESEGFGSCSNHRYCERVCPKGISVSNITKMNQVL
GWA
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaattttactctacatatttggcgacaaaaaaacggcgatattaaaggggactttgtc
acttatcagattgataatattgatgaagatacctcgtttttggagatgcttgaccaactc
aatgaacagcttattgccaaagatcaagattgtattgtttttgattatgattgccgtgaa
ggtatttgtggcgcttgttcattggttatcaatggctatccacatggtgataaaaaagcc
acaacaacgtgccaactgtatatgcgtgattacaagcatcaaactgagctatgggtagag
ccttggcgcgctgaatcgtttccagtgatcaaagacttaacggttgatcgaacctcattt
gacaatattattcaatcaggtggttacgtatcagtgcatactgggtctgcacctgaggcg
aatgctttgttggtggataagcatagcgcagatgaagcttttaattcagccacctgtatt
ggttgtggcgcttgtgttgctgtatgtccaaatgcatcggcaaccttgtttgttgccgct
aaaattacacacttatcgttattgccacaaggtaagattgaagaacaagatcgtgcacaa
aaaatgtttaatcaaatggaaagtgaaggctttggcagttgttcaaatcatcggtattgt
gagcgtgtatgtcctaaagggatttcggtttctaatattaccaagatgaatcaagttctt
ggttgggcgtaa

DBGET integrated database retrieval system