KEGG   Candidatus Thioglobus autotrophicus: SP60_06390Help
Entry
SP60_06390        CDS       T04079                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
tho  Candidatus Thioglobus autotrophicus
Pathway
tho00473  D-Alanine metabolism
tho00550  Peptidoglycan biosynthesis
tho01100  Metabolic pathways
tho01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:tho00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SP60_06390
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SP60_06390
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    SP60_06390
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tho01011]
    SP60_06390
Enzymes [BR:tho01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SP60_06390
Peptidoglycan biosynthesis and degradation proteins [BR:tho01011]
 Precursor biosynthesis
  Amino acid ligase
   SP60_06390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp_3 CPSase_L_D2 ATPgrasp_ST RimK TTL ATP-grasp ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: ALE52860
UniProt: A0A0M5LL84
LinkDB All DBs
Position
complement(1187006..1187887)
Genome map
AA seq 293 aa AA seqDB search
MIAVLMGGNSAERKVSLDSGEAVYQALKSQHIACFKFDWHGDNLNNLWSQKFDLAFIVLH
GRGGEDGVIQKQLEDRHIAYTGSNSTASANGMDKHLCKEIWQSENLPLAASVLVNKESQL
PDINFPLPWAVKPASEGSSIGISKVTNRSQLDSALTLAQRYDDKILIEQWIAGEEYTVAI
LGNKTLPVIKIVTDQDFYNYESKYLSNTTQYLCPCDLSKEQENQLQKIALKAFQAINATG
WGRVDFILDKHNAPCLLEINTVPGMTSHSLVPMAAKAAGITFEQLVQQIIDEA
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgattgcagtattaatgggtggcaactctgctgaacgaaaagtgtctttagatagtgga
gaggctgtttaccaagcattaaaatctcaacacattgcctgctttaaatttgactggcat
ggtgacaacctaaacaacctctggtcgcaaaaatttgacttagcctttattgtcttacat
ggtcgcggtggtgaagatggggtgatacaaaaacaactggaagatcgtcatattgcctat
actggctccaattcaactgccagtgcaaatggcatggataaacacctatgcaaagaaatt
tggcagtctgaaaacctgcctttggcggcttctgttctagtcaataaagagtctcaactg
cctgatattaacttccctctgccttgggcggttaagccggcttcagaaggatctagcatc
ggcattagcaaagtcaccaatcgctcgcaactcgacagtgctctaacacttgctcagcgc
tatgatgacaaaatattaattgaacagtggattgcaggagaagagtatacggttgccata
ttgggtaataagactctgcctgtcattaaaattgtcaccgaccaggacttttataattat
gaatccaaatacctatcaaacaccactcaatacctttgcccctgcgacttaagcaaagaa
caagaaaaccaattacaaaaaattgcactaaaagcttttcaagcgatcaatgcaacaggc
tgggggagagtcgactttattctagataagcataacgcaccttgtttattagaaattaac
acggttcctggtatgacctctcattcgctagtgccaatggctgctaaagcagcaggcatt
acctttgaacaactggttcaacaaattatcgatgaagcttaa

DBGET integrated database retrieval system