KEGG   Thermosipho sp. 1063: BG95_02810Help
Entry
BG95_02810        CDS       T04625                                 

Gene name
porA
Definition
(GenBank) pyruvate ferredoxin oxidoreductase
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
thp  Thermosipho sp. 1063
Pathway
thp00010  Glycolysis / Gluconeogenesis
thp00020  Citrate cycle (TCA cycle)
thp00620  Pyruvate metabolism
thp00640  Propanoate metabolism
thp00650  Butanoate metabolism
thp00680  Methane metabolism
thp01100  Metabolic pathways
thp01110  Biosynthesis of secondary metabolites
thp01120  Microbial metabolism in diverse environments
thp01130  Biosynthesis of antibiotics
thp01200  Carbon metabolism
Module
thp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:thp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BG95_02810 (porA)
   00020 Citrate cycle (TCA cycle)
    BG95_02810 (porA)
   00620 Pyruvate metabolism
    BG95_02810 (porA)
   00640 Propanoate metabolism
    BG95_02810 (porA)
   00650 Butanoate metabolism
    BG95_02810 (porA)
  09102 Energy metabolism
   00680 Methane metabolism
    BG95_02810 (porA)
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    BG95_02810 (porA)
Enzymes [BR:thp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     BG95_02810 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N GTP_EFTU_D4
Motif
Other DBs
NCBI-ProteinID: APT71895
UniProt: A0A1L7BE76
LinkDB All DBs
Position
559225..560403
Genome map
AA seq 392 aa AA seqDB search
MPEVKNRQAVTGAQAVANAMRQINPDVVAAYPITPQTPVVEYFAQYVADGLADTEMIPVE
SEHSAMSAVVGAAAAGARAMTATAANGLALMHEIVYIAASSRLPIVMPVANRALSGPINI
HCDHSDAMAERDSGWIQLWAENAQEAYDFTIMAIRLAEHEDIRLPVMVNFDGFIISHGVE
VVDFLDDEVVKKFVGEPKVKYPLLDVDNPVTHGPLDLYDYYFEHKRQQIEAMKHVYKVFN
KVAEEFAKISGRKYNILDAYKVEDAEYVMIALGSTAGTIKYTVDLLREEGHKVGVIKPQI
FRPFPKTELQGLLNGRKAVIVLDRSASFGAEAPLYEAVKSSLYELAVKPQLGSYVYGLGG
RDIKIEHIRKAFEDAFAGNLIADEERYLGLRE
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
gtgccagaagtaaaaaatagacaagctgtgactggagcacaagcagttgcaaatgcaatg
cgtcaaataaatccagatgtggttgcagcgtatcctattactccacaaactccagtagtt
gaatattttgcacaatacgtagccgatgggcttgcagataccgaaatgatccccgttgaa
agtgaacacagtgcaatgagtgctgttgtaggtgcagctgcagcaggtgcaagggctatg
acagcaacagcagcaaacggtcttgcactaatgcacgaaattgtatatatagctgcttca
tctagattaccaatagtaatgccagttgcaaatagggcactttctggaccaattaatatc
cactgtgatcacagtgatgctatggcagaaagagattctggttggattcaactttgggca
gaaaatgctcaagaagcatatgattttacaataatggcaataagacttgcagaacatgaa
gatataagattaccggtaatggtcaatttcgatggttttattatttctcacggcgttgaa
gttgttgattttctagatgacgaagtagttaaaaaatttgttggagaaccaaaagtaaaa
tatccattgcttgatgtagataatcctgtaacacatggtccattagatttgtacgactac
tactttgaacacaaaagacaacaaatcgaagcaatgaaacacgtatacaaggtgtttaat
aaagttgctgaagaatttgcaaaaatttctggaagaaaatacaatattttggatgcatat
aaagtagaagatgcagaatacgtcatgatagcacttggttctactgcaggaacaattaaa
tatactgtagatttattaagagaagaaggtcataaagtaggagtaattaaaccccaaata
tttagacctttcccaaaaacagaactccaaggattgttaaacggaagaaaagcagtaatt
gtacttgatagatccgcttcttttggtgcagaagcacctttatacgaagcagttaaaagc
tctctttacgaattagccgttaaacctcaattgggaagttatgtttacggacttggtggt
agagatattaagatagaacacattagaaaggcatttgaagatgcatttgctgggaattta
attgcagacgaagaaagatatctaggactcagagaatga

DBGET integrated database retrieval system