KEGG   Thermotoga sp. 2812B: T2812B_04695Help
Entry
T2812B_04695      CDS       T03494                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
thq  Thermotoga sp. 2812B
Pathway
thq00010  Glycolysis / Gluconeogenesis
thq00020  Citrate cycle (TCA cycle)
thq00620  Pyruvate metabolism
thq00633  Nitrotoluene degradation
thq00640  Propanoate metabolism
thq00650  Butanoate metabolism
thq00680  Methane metabolism
thq01100  Metabolic pathways
thq01110  Biosynthesis of secondary metabolites
thq01120  Microbial metabolism in diverse environments
thq01130  Biosynthesis of antibiotics
thq01200  Carbon metabolism
Module
thq_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:thq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    T2812B_04695
   00020 Citrate cycle (TCA cycle)
    T2812B_04695
   00620 Pyruvate metabolism
    T2812B_04695
   00640 Propanoate metabolism
    T2812B_04695
   00650 Butanoate metabolism
    T2812B_04695
  09102 Energy metabolism
   00680 Methane metabolism
    T2812B_04695
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    T2812B_04695
Enzymes [BR:thq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     T2812B_04695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N Glycogen_syn
Motif
Other DBs
NCBI-ProteinID: AIY86482
LinkDB All DBs
Position
complement(966429..967607)
Genome map
AA seq 392 aa AA seqDB search
MERVVERVAVTGAEAVANAMRQIEPDVVAAYPITPQTPIVEYFARFVADGVVRTEMIPVE
SEHSAMSAVVGAAAAGARAMTATSANGLALMHEIVYIAASYRLPIVMPVVNRALSGPINI
HCDHSDAMAERDSGWIQLFAETNQEAYDFTILAVRLAEHEDVRLPVMVNLDGFILSHGVE
PVEFYPDELVKKFVGELKPMYPLLDTEHPVTWGPLDLYDYYFEHKRQQIEAMENVKKVFP
EIAKEFEETFGRKYWFVEPYRMEDAEHVMVALGSTNSTIKYVVDELREEGYKVGSLKIWM
FRPFPKEQLQELLNGRKSVVVLDRAVSFGAEAPLYEAVKSALYEVAARPMLGSYVYGLGG
RDIKPEHIRKAFEDAINGNLIADEQRYLGLRE
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggaaagggtcgtcgagagagtggccgttaccggtgctgaggccgttgccaatgcgatg
agacagatagaacccgatgtcgttgcggcgtacccgatcactccacagacacctattgtg
gagtactttgccaggttcgtcgcagacggcgttgtcaggacagaaatgattcccgtcgaa
agtgaacacagtgcgatgagtgctgttgttggagccgctgccgcgggagcaagagcgatg
acggcaaccagtgcaaatggactcgcactgatgcacgaaatagtttacatcgctgcctcc
tacagacttcctatcgtgatgcccgttgtgaacagagcgctcagtggtcctataaacatt
cactgtgaccacagcgacgcgatggcagaaagggattccgggtggattcagctctttgcg
gaaaccaatcaggaggcttacgatttcaccattctcgctgtgagactggcagaacacgaa
gatgtgagacttcccgtcatggtgaacctcgatgggttcatcctttctcacggagtggaa
cccgttgagttctatcccgatgaactcgtgaaaaagttcgtcggagagctcaaacccatg
tatcctcttctggataccgaacaccccgtaacctggggtccactcgatctttacgattac
tacttcgaacacaaaagacagcagattgaagccatggaaaacgtaaagaaggtgttcccg
gaaatcgcaaaagaattcgaagaaacgtttggaaggaaatactggttcgtcgaaccgtac
agaatggaagacgcagagcacgtgatggtagcactgggctctacaaacagcacgataaag
tacgtggttgatgaactgagagaagagggctacaaagtcggctctttgaagatctggatg
ttcaggccgttcccgaaggaacagcttcaggaactcctcaatggaagaaagagtgtggtt
gtgctcgacagagcggtttccttcggagcggaagcacctctctacgaagcagtgaaatct
gcgctctacgaagtagcagcgaggccgatgcttggatcctatgtctacggtctcggtgga
agggacatcaaaccagagcacatcagaaaagcgttcgaagatgccataaacggaaacctc
atagcagacgaacagagatacctcgggctcagagagtga

DBGET integrated database retrieval system