KEGG   Thermotoga sp. RQ7: TRQ7_01225Help
Entry
TRQ7_01225        CDS       T03669                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
thr  Thermotoga sp. RQ7
Pathway
thr00010  Glycolysis / Gluconeogenesis
thr00051  Fructose and mannose metabolism
thr00562  Inositol phosphate metabolism
thr01100  Metabolic pathways
thr01110  Biosynthesis of secondary metabolites
thr01120  Microbial metabolism in diverse environments
thr01130  Biosynthesis of antibiotics
thr01200  Carbon metabolism
thr01230  Biosynthesis of amino acids
Module
thr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
thr_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:thr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TRQ7_01225 (tpiA)
   00051 Fructose and mannose metabolism
    TRQ7_01225 (tpiA)
   00562 Inositol phosphate metabolism
    TRQ7_01225 (tpiA)
Enzymes [BR:thr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TRQ7_01225 (tpiA)
Exosome [BR:thr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TRQ7_01225 (tpiA)
  Exosomal proteins of bladder cancer cells
   TRQ7_01225 (tpiA)
  Exosomal proteins of melanoma cells
   TRQ7_01225 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AJG40094
UniProt: A0A0B5KN88
LinkDB All DBs
Position
complement(228717..229472)
Genome map
AA seq 251 aa AA seqDB search
MILAGNWKMHKTISEAKKFVSLLLNELHDVKEFEIVVCPPFTALSEVGEILSGRNIKLGA
QNVFYEDQGAFTGEVSPVMLKEIGVEYVIVGHSERRRIFKEDDELINRKIRAVLEKGMTP
IFCVGETLEEREKGLTFCVVEKQIREGLYGLSREEAQKVVIAYEPVWAIGTGKVATPQQA
QEVHAFIRRLLSEMYDDETAETIRILYGGSIKPDNFLGLIVQKDIDGGLVGGASLKESFV
ELARIMKGVIS
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
ttgattcttgccggaaactggaagatgcacaagaccatatctgaggcaaaaaaattcgtg
tcgctccttctgaacgaactgcacgatgtgaaagagttcgagatagtggtctgtccgccg
ttcaccgcactatccgaagttggagagatcctctcgggtagaaacatcaaactcggtgct
caaaacgtcttctacgaggaccagggggcgttcacgggagaagtgtcaccggttatgctg
aaagaaatcggcgttgagtacgtgatcgtgggacactccgaaagaaggcgcatcttcaag
gaagacgatgaactgataaacagaaagatcagggctgttcttgaaaagggaatgacaccc
atcttctgtgtgggtgaaactctggaggaaagagaaaagggtctcacgttctgcgttgtt
gaaaaacaaataagagaaggactttacggtctcagcagagaggaagcacagaaggtggtc
atagcctacgaacccgtgtgggcgatcggaacaggaaaggtagcaacaccacagcaggct
caggaagtgcatgcgttcataagaaggcttctttctgagatgtacgacgatgaaacggct
gagacgatcaggatactctacggtggtagcataaaaccagacaacttcctcggcctcatc
gttcagaaagacatcgatggtggtctggttggaggagccagtctgaaagaatcctttgtg
gaacttgcaagaataatgaagggagtgatttcctga

DBGET integrated database retrieval system