KEGG   Thermotoga sp. RQ7: TRQ7_08490Help
Entry
TRQ7_08490        CDS       T03669                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
thr  Thermotoga sp. RQ7
Pathway
thr00500  Starch and sucrose metabolism
thr01100  Metabolic pathways
thr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:thr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TRQ7_08490
Enzymes [BR:thr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     TRQ7_08490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphorylase DUF3417
Motif
Other DBs
NCBI-ProteinID: AJG41479
UniProt: A0A0B5KSA9
LinkDB All DBs
Position
complement(1632579..1635050)
Genome map
AA seq 823 aa AA seqDB search
MSKKLPENLKHLEELAYNLWWSWSRPAQRLWRKIDPEGWEEHRNPVKILKEVSDERLEEL
SKDDDFISLYELTLERFKDYMEKEDTWFNVNYPEWDEKIVYMCMEYGLTKALPIYSGGLG
ILAGDHLKSASDLGLPLIAIGLLYKHGYFTQQIDRDGKQIEIFPDYNPEDLPMKPLKDEK
GNQVIVEVPLDSTVVKARVFEVKVGRVSLYLLDPDFEENEEKYRKICNYLYNPEPDVRIS
QEILLGIGGMKLLRALNLKPGVIHLNEGHPAFSSLERIKNYMEEGYSFTEALEIVRQTSV
FTTHTPVPAGHDRFPFDLVEKKLSKFFEGFEKKNLLMDLGKDETGSFNMTYLALRTSSFI
NGVSKLHAEVSRRMFKNVWQGVPVEEIPIEGITNGVHMGTWINREMRKLYDRYLGRVWRD
HTDLEGIWYGVDRIPDEELWQAHLRAKKRFIEYIKESVRRRNERLGIDEDVPNIDENSLI
IGFARRFATYKRAVLLLSDLERLKKILNDPERPVYVVYAGKAHPRDDAGKEFLKRIYEVS
QMPEFKNRIIVLENYDIGMARLMVSGVDVWLNNPRRPMEASGTSGMKAAANGVLNASVYD
GWWVEGYNGRNGWVIGDESVLPETEVDDPRDAEALYDLLENEIIPTYYENKEKWIFMMKE
SIKSVAPRFSTTRMLKEYTEKFYIKGLVNKEWLERKENAERFGAWKERILRNWSSVSIER
IVLEDTRSVEVTVKLGDLSPDDVLVELLIGRGESMEDLEIWKVIQIRKHRREGDLFIYSY
VNGALGHLGSPGWFYAVRVLPYHPKLPTRFLPEIPVVWKKVLG
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgaagaaacttccggagaacctgaagcatctggaagaactcgcttacaacctctgg
tggagctggtcaaggcccgctcaaaggctctggagaaagatcgatccggaaggctgggag
gaacacagaaatcctgttaaaatactgaaagaagtttctgatgaaagactcgaagagctt
tcaaaagatgacgatttcatatccctctatgaactcacccttgaaaggttcaaggactac
atggagaaagaagacacctggttcaacgtgaactaccccgaatgggacgagaagatcgtc
tacatgtgtatggagtacggtttgaccaaagcccttccgatctattccggtggtcttgga
atcctcgcgggagaccatctcaaatccgcaagcgatcttggacttcctctcatagcgatc
ggacttctctacaaacatggatatttcacccagcagatcgacagagatggaaaacagata
gagattttccctgattacaacccagaggacttacccatgaagcccctgaaggatgaaaag
ggaaaccaggtgatcgtggaggttcctctcgacagtaccgttgtgaaggcacgtgttttt
gaagtgaaggtaggaagggtgagtctgtacctgctcgatccggactttgaggaaaacgag
gaaaaatacagaaagatctgcaactacctttacaacccggaacccgatgtgaggatctcc
caggagatactcctcggaattgggggaatgaaacttctcagggcgctgaacctgaaacca
ggagtcatccatctgaacgaaggacatccggcgttctcttccctcgaaaggataaagaac
tacatggaagaaggatattccttcacagaggcccttgagatcgtgaggcagacgagtgtg
ttcacaacccacacacccgttcccgctggacacgacagatttccctttgacctcgtggaa
aagaaactttcgaaattcttcgaaggattcgaaaagaaaaatcttctcatggatcttggg
aaagatgaaacaggcagtttcaacatgacgtatcttgctctgagaacatcctccttcata
aacggtgtcagcaaactgcatgcggaagtttccagaaggatgttcaaaaacgtgtggcag
ggtgttcccgtggaggaaataccgatcgaagggataacgaacggcgttcacatgggaacc
tggatcaaccgtgagatgagaaaactgtacgacagatatctcggaagggtatggagagat
cacaccgaccttgagggtatctggtacggtgttgacaggattccagatgaagaactctgg
caggctcacctgagggcaaagaagagattcatcgagtacataaaagaatcggtaagaaga
agaaacgagagactgggaatcgacgaagatgtgccgaacatcgatgaaaattcgctcatc
ataggttttgcaagaaggtttgccacttacaagagggcagttctcctgctcagcgatctg
gagagactcaagaagatcctcaacgatccagaaagacccgtttacgtggtctatgcgggg
aaggcccatccaagggacgatgcggggaaggaatttttgaaacgcatctacgaagtctcg
cagatgcctgagttcaaaaacaggatcatcgtactggaaaactacgacattggaatggca
cggctcatggtgtcgggagtggatgtgtggctgaacaacccgagaagacccatggaagca
agtggaacaagcggaatgaaggcagcagccaacggagttcttaacgcgagtgtttacgat
ggatggtgggttgaagggtacaacggcagaaacggctgggtcataggcgatgaaagcgtt
cttccagagacggaagtggacgatcccagggacgcagaagcactctacgatctcctcgaa
aacgaaatcatcccaacctactacgaaaacaaagaaaagtggatcttcatgatgaaagag
agcataaagagtgttgctccaagattcagcaccaccagaatgctcaaagaatacacggag
aagttctacataaagggacttgtgaacaaagaatggcttgaaagaaaagaaaacgccgaa
aggtttggtgcatggaaggaaaggatcctcagaaactggagcagcgtttccatagaaaga
atcgtccttgaggacacaaggagtgttgaggtgacggtgaaactgggagacctttcacct
gatgatgtactggttgaacttttgattggaagaggagaaagcatggaagatctggagatc
tggaaggtgatacagataagaaagcacagaagggaaggggatctgttcatctacagttat
gtcaacggtgccctcggtcatcttggctctccgggatggttctacgcggtgagggtgcta
ccttatcatccgaaacttcccaccagattcttgccggagatacctgtggtgtggaaaaag
gttctcgggtga

DBGET integrated database retrieval system