KEGG   Thermococcus paralvinellae: TES1_0121Help
Entry
TES1_0121         CDS       T03005                                 

Definition
(GenBank) Zinc-binding alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
ths  Thermococcus paralvinellae
Pathway
ths00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:ths00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    TES1_0121
Enzymes [BR:ths01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     TES1_0121
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     TES1_0121
    1.1.1.-  
     TES1_0121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C 2-Hacid_dh_C DAO ADH_zinc_N_2 Sacchrp_dh_NADP Pyr_redox_3 ADH_N_assoc F420_oxidored AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AHF79518
UniProt: W0I565
LinkDB All DBs
Position
complement(127730..128794)
Genome map
AA seq 354 aa AA seqDB search
MLAIRWYGKRDLRLEEVREPSIKPGFIKIKVKACGVCGTDLNEYLNGPIFIPTKEPHPLT
GKTAPVTIGHEFAGEVVEIGAGVKGFEVGDRVAVFPVIHCGECYFCKRGMENLCVNFGVT
GLSEDGGFAEYALVRPYQAYKIPESVSFEEGALVEPLSVGVRAVKKAQLMPGDSVVIIGA
GPIGLCVLLVAKASGAGKIIVVEPSKARRKKAEEIGADITINPSGKSVEEVIEEIRGETE
LGADVSFECVGLNETFKVAVESIRKGGKAVALGVFKCLTSFDAKGLVVGEKSIIGSVSHS
ADDFCRGISLVASKRVDVRPLITSKVKLEEIVEKGFEELIKNRDKHVKILAAEI
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcaattagatggtacgggaagagagacctaaggctcgaagaagttagagagcca
agtataaaaccaggcttcattaaaatcaaagtaaaagcctgtggcgtctgtgggacagac
ttaaatgagtatctaaatggtccaatttttataccaaccaaagagccccaccctctcaca
ggaaaaactgctccagtcaccattggtcatgaatttgctggcgaggttgttgaaattgga
gcaggagttaaaggctttgaagtaggtgatagggttgccgtctttccagtaattcactgc
ggtgagtgctacttttgtaagagaggtatggaaaacctatgtgtaaactttggagtaaca
gggttaagtgaagacggaggttttgccgaatatgccttagtcaggccatatcaggcatac
aaaataccagagagcgtttcatttgaagagggtgcattagttgaaccactctcagtcggc
gttagagctgttaaaaaggctcagctgatgcccggtgacagcgtagtgataattggtgct
ggacccattggcttatgtgtccttttagttgcaaaagcttctggagcagggaaaataatt
gttgtagagccttccaaagctaggagaaagaaggcagaggagatcggtgctgatataaca
attaatccaagtggaaaaagtgttgaagaggttatcgaagagataagaggagagacagaa
cttggggctgatgtcagctttgagtgtgttggactaaacgaaacgttcaaggttgctgtg
gaaagcataagaaaaggtggtaaagcagttgctctgggagtttttaaatgtctgacatct
ttcgatgctaaaggacttgtagttggagaaaagagtataattggatcggtctcccacagt
gccgatgacttctgcaggggaatttctttagttgcatcaaagagggttgacgttaggcct
ttaataacttcaaaggttaaactggaagaaatagtagagaaaggcttcgaggagctcata
aaaaacagagataaacacgtgaagatacttgctgctgaaatataa

DBGET integrated database retrieval system