KEGG   Thermococcus paralvinellae: TES1_0272Help
Entry
TES1_0272         CDS       T03005                                 

Definition
(GenBank) Hypothetical protein
  KO
K07468  putative ATP-dependent DNA ligase [EC:6.5.1.1]
Organism
ths  Thermococcus paralvinellae
Brite
KEGG Orthology (KO) [BR:ths00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    TES1_0272
Enzymes [BR:ths01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     TES1_0272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lig_C RNA_ligase DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: AHF79667
UniProt: W0I4J8
LinkDB All DBs
Position
250641..251783
Genome map
AA seq 380 aa AA seqDB search
MVSLYFKHILLKLGLDEERIETLEMKGGIVEDEFEGLRYLRFKDSAKGLRRGTVVFNESD
IVLGFPHIKRVVHLRNGVKRVFKSKPFYVEEKVDGYNVRVAKIGEKILALTRGGFVCPFT
TERIGDFINEQFFRDYPDLVLCGEMAGPESPYLVEGPPYVEEDIQFFLFDIQEKRTGRSL
PVGERLKLAEEYGIQSVEVFGLYSYEKIDELYELIERLSREGREGIVMKSPDMKKIVKYV
TPYANVNDIKIGSRIFFDLPHGYFMQRIKRLAFYIAEKRIRGEDFDDYAKALGKALLQPF
VESIWDVAAGEMIAEIFTVRVKRIETAYKMISHFERMGLNIHIDDIEELGNGYWKITFKR
VYDDATKEIRELWNGHTFVD
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcttgtacttcaaacacattctcctcaagcttggacttgatgaagagagaata
gagactctagaaatgaaaggtggcatagttgaggatgaatttgagggtttacgctatctt
aggtttaaagactcagccaaaggtctgagaagaggaacggttgtctttaacgaatctgac
attgttcttggatttccccatataaagagagttgtccatctaagaaatggtgtaaaaaga
gttttcaaaagcaagccgttctatgtggaggagaaagttgatggttacaacgttagagtc
gctaagattggagaaaagattttggctttaacaagaggtggttttgtttgtccgttcact
actgaaaggattggggacttcataaacgagcaattctttagggattaccctgatttagtt
ctatgtggagagatggctggtccagagagtccatatttagtcgaaggtccgccatatgtt
gaggaagatattcagtttttcctctttgatatccaagaaaagagaactggaaggagctta
ccagttggggaaaggttaaagctggctgaagaatacggcattcagagcgttgaagtcttc
ggtctctatagctatgaaaagattgatgaactttacgaattgattgagagactcagcagg
gagggacgagaaggcatagtcatgaaaagtccggatatgaagaaaatcgtgaagtatgta
acgccctatgcaaatgttaacgacataaagattggctcaaggattttctttgatttgcct
cacggctacttcatgcagcgcataaagaggttagcattttatattgcagagaagcgcata
aggggagaggactttgatgattatgcaaaagcccttggaaaagctttgctccagccgttt
gtggagtcaatatgggatgttgcggctggcgagatgattgctgagattttcacggttagg
gtaaaaagaattgagaccgcttataagatgatatctcattttgagagaatggggcttaac
attcacattgatgacattgaggaacttggcaacggctactggaaaattacattcaagagg
gtttatgacgacgcaactaaggaaatcagagagctttggaatggacatacttttgtggat
taa

DBGET integrated database retrieval system