KEGG   Thermococcus paralvinellae: TES1_0299Help
Entry
TES1_0299         CDS       T03005                                 

Definition
(GenBank) glycogen phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
ths  Thermococcus paralvinellae
Pathway
ths00500  Starch and sucrose metabolism
ths01100  Metabolic pathways
ths01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ths00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TES1_0299
Enzymes [BR:ths01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     TES1_0299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphorylase DUF3417 Glyco_transf_5
Motif
Other DBs
NCBI-ProteinID: AHF79693
UniProt: W0I5M1
LinkDB All DBs
Position
277032..279533
Genome map
AA seq 833 aa AA seqDB search
MDVELIIKKKLPENIRGLVKLAYNYWWSWSHKATKMWMYIDEEHWREYKNPVKLLLDVSD
ERLKELARNDDFLDLYELVMNNFEKYMSEENTWFSVNYPKWDKPIVYLCMEYGISKSLPI
YSGGLGILAGDHIKTASDLGLPFIAIGLLYKHGYFKQEIDENGRQIEIFPSYNPKEMPMK
QIFKENGEPLLIEVPIEDRIVYARVFEVNVGRVKLYLLDTDVEENSEEDRKICDYLYNAE
LDKRIKQEILLGIGGMRLLKALKIEPGVIHLNEGHPAFANFERIVWYMQEGLSFEEALEV
VRGTSVFTTHTPVPAGHDVFPVWFVEEKLTKFFEGLPKEKFLALGKVEEEDPNFNMSLLA
IKTSNFVNGVSKLHAEVTKKMWLNLWKGVPLDEIPVEGITNGIHTSTWVHEKLARLYDRY
MGKVWREHVNLEGIWYAIERIPDEELWEAHLKAKRDLIELIKRKIRERNARLGIDEPAPE
IDENALIIGFARRFATYKRATLILTDLERLKRIVNNPERPVYIIFAGKAHPRDEAGKEFL
RRVYEVSQMPEFRGKIIVIENYDMGSARLMVAGVDVWLNNPRRPLEASGTSGMKAGLNGV
LNLSIYDGWWVEGYNGRNGWVIGEETTEPETEEDDIKDAQSLYDILENEVIPLYYENKEA
WIGMMKESIKSIAPRFSTHRMVKEYMTKFYTKAMEHGIWLIRDNFRWAREIAAWKKKVLE
NWDKVSIEKILTEDAKAVEAIVNLGNLSPEDVKVELYYGVKAKDYIIEKPYIVELKRPEH
LGNGRYKYKYEGNALRNIVNPCWHYAVRVYPYHPKLPYKFLLGGLIRWRGLLE
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atggatgtggaattaattatcaagaaaaagttgcctgaaaatattagaggcttagtgaag
cttgcctataattattggtggagttggagtcacaaagccactaaaatgtggatgtatatt
gatgaagagcattggagggaatacaaaaatcctgtgaagcttctccttgatgtgagcgat
gaaagattaaaagagcttgcaaggaatgatgatttccttgatttatatgagctcgtcatg
aataattttgaaaaatacatgagtgaggaaaacacctggttttcagttaactatcccaaa
tgggataaaccaatagtttacctatgtatggagtatggtatcagtaagagccttccaatt
tattcgggtggtcttggaattcttgctggtgatcacataaaaacggcaagcgacttaggt
ttgcctttcatcgcaattggtctcctctacaagcatggctactttaagcaggagatagat
gaaaacggtagacagattgagatattccccagctacaatcccaaagaaatgccaatgaag
cagatttttaaagaaaacggtgagccccttttaattgaagttccaattgaagacagaata
gtttatgcgagagtttttgaagtaaatgttggaagagttaagctatacctccttgatacg
gacgttgaggagaacagcgaagaagacagaaaaatatgtgattacctttacaacgctgag
cttgacaagagaattaagcaagagattctgcttggaattggtggaatgcgtcttttgaaa
gcactcaagattgagcctggtgtaattcatctcaatgaaggccatccagcatttgcgaac
tttgagagaattgtatggtatatgcaagaaggtctcagttttgaagaagctttagaggta
gttagaggaacaagtgttttcacaactcatacaccagttccagcaggtcatgatgttttc
ccagtatggtttgttgaagaaaagctcacaaagttctttgaaggtttacccaaagagaag
ttcttggcattgggcaaggttgaggaggaagacccgaactttaacatgagccttttagct
ataaaaacttcaaacttcgtaaatggggtcagcaaacttcacgctgaagttacaaagaaa
atgtggttgaatctctggaaaggagttccgctcgatgaaattccagttgagggcataaca
aatggaatccacacatccacgtgggttcacgaaaagttggctcgcctatatgacagatat
atgggaaaggtctggagagaacatgtaaacttggaaggcatttggtatgcaattgaaaga
attccagatgaggagctttgggaagcacatctaaaagccaagagggatttaattgaactt
atcaagaggaagattagggaaaggaatgctcgcttaggcattgatgaaccagctccagaa
attgatgagaatgctttaataataggatttgcaaggagatttgcaacgtataaaagagca
accttaattttgactgaccttgagcgcttaaagaggatagtgaacaatccagagagaccc
gtttatataatctttgcaggaaaagctcatccaagagatgaagctggaaaggagttcttg
aggagagtttacgaagtttcccagatgcctgaatttagaggcaagataattgttatagaa
aactatgacatgggttctgctcgtttgatggttgccggcgttgatgtatggctcaacaat
ccaaggagacctcttgaagctagtggaacaagcggtatgaaagctggacttaacggcgtc
ttaaacttgagcatctatgatggctggtgggttgagggctacaacggaagaaacggctgg
gttataggagaagaaacaacagaaccagagactgaagaagacgatataaaggatgctcaa
agcttgtatgatatccttgagaatgaggtaattccactctattatgaaaataaggaagca
tggatcggcatgatgaaagagagcataaaaagcatagcaccgagattcagcacccacaga
atggttaaggaatacatgacaaagttctatacaaaggctatggagcacggtatctggctt
attagagacaacttccgttgggcaagggagatagcagcctggaagaagaaagtgctcgaa
aattgggacaaggtgagcattgaaaaaatacttacagaagatgccaaagcagtggaagct
attgtaaaccttggaaatctaagtcctgaggatgtgaaagttgaactttattatggagtg
aaagccaaggactacatcattgagaagccatatatagttgaactcaaaagaccagagcat
ctgggcaatggaagatacaaatacaaatacgagggcaatgctttgcggaatatagttaac
ccatgctggcattatgcagtgagagtttacccctaccacccaaagctgccatacaaattc
cttcttggcggcttgatcaggtggcgtggactgcttgaatga

DBGET integrated database retrieval system