KEGG   Thermococcus paralvinellae: TES1_0540Help
Entry
TES1_0540         CDS       T03005                                 

Definition
(GenBank) Tungstate ABC transporter, ATP-binding protein WtpC
  KO
K15497  molybdate/tungstate transport system ATP-binding protein [EC:7.3.2.5 7.3.2.6]
Organism
ths  Thermococcus paralvinellae
Pathway
ths02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ths00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    TES1_0540
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ths02000]
    TES1_0540
Enzymes [BR:ths01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.5  ABC-type molybdate transporter
     TES1_0540
    7.3.2.6  ABC-type tungstate transporter
     TES1_0540
Transporters [BR:ths02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Molybdate/tungstate transporter
    TES1_0540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran TOBE TOBE_2 AAA_21 SbcCD_C SMC_N AAA_29 OB_MalK AAA_23 CysA_C_terminal IstB_IS21 AAA_16 AAA_5 RsgA_GTPase AAA_30
Motif
Other DBs
NCBI-ProteinID: AHF79932
UniProt: W0I5E5
LinkDB All DBs
Position
501751..502785
Genome map
AA seq 344 aa AA seqDB search
MLRVENVSKDWKEFKLRNISFEVNKGEYFIILGPSGAGKTLLLEVIAGIFIPDSGRIFMN
DEDITFLPPEKRDLAYIPQNYALFPHMRVYDNIAYGLKLRKISKVEIEKKVKEIAEILGI
SHLLHRKPKTLSGGEAQRVAIARALVLEPKLLLLDEPFANLDVQTRAKLIQEMKRWRKEL
NFTALHVTHSFEEAVSLGDRVGVMLNGKLIQTGEVREVFGKPKNEEVARFLGFENIIDGI
AEGRILKANGILIELPTEAKGKVRIGIRPEDIIISNEPIKTSARNEFKAKVLAIEDLGSL
IRLTLDIGGIELKAFITRSSLIEMGIKEGKEVYVSFKATAIHVF
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgcttagggttgaaaatgtaagcaaagactggaaagagtttaagctcagaaacataagc
tttgaagtcaataaaggagagtatttcataattctgggtccaagtggtgcaggaaaaact
cttcttcttgaagttatcgctggaattttcatcccagattctgggaggattttcatgaac
gatgaggacataactttcttacctccagaaaagagggatcttgcatatattcctcaaaat
tatgcactcttcccccatatgagagtctacgacaatattgcttacggattaaaactaaga
aaaatttccaaagtagagattgagaaaaaggttaaagaaattgcagaaatcctcggaatt
tctcatcttttacatagaaagccaaaaacactaagcggcggtgaggctcagagagttgcc
attgcaagagctttggttttagagccaaagcttcttctcttagatgaaccttttgcaaat
ctcgatgtccaaaccagagctaagctcattcaagagatgaagcgctggcgtaaggagctc
aactttacagctctacatgtgactcattcttttgaggaagctgtgagcttaggagacaga
gttggagtaatgctgaatggaaagttgattcaaacaggagaagtcagagaagtgtttgga
aaaccaaagaatgaagaagtcgcgagatttcttggctttgaaaacataattgatggtatt
gcagagggaagaattttgaaagcaaatggaattctaattgaactgccgacagaggctaaa
ggaaaggttagaattggtataaggcctgaggacataatcatatctaatgaacccataaag
acctctgcaaggaatgaatttaaagcaaaggttttggcaattgaggatctgggttctctg
attagattaacccttgatattggtggaattgagcttaaagcctttataacccgttcttct
ttgattgaaatggggattaaggaaggaaaagaagtttatgtaagctttaaagcaacggca
atccatgtattttaa

DBGET integrated database retrieval system