KEGG   Thermococcus paralvinellae: TES1_0685Help
Entry
TES1_0685         CDS       T03005                                 

Definition
(GenBank) Ribulose-1,5-bisphosphate carboxylase, Type III
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
ths  Thermococcus paralvinellae
Pathway
ths00630  Glyoxylate and dicarboxylate metabolism
ths01100  Metabolic pathways
ths01120  Microbial metabolism in diverse environments
ths01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ths00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    TES1_0685
Enzymes [BR:ths01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     TES1_0685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N DUF697
Motif
Other DBs
NCBI-ProteinID: AHF80073
UniProt: W0I6Q3
LinkDB All DBs
Position
640845..642176
Genome map
AA seq 443 aa AA seqDB search
MPEKFEIYDQYVDKEYEPNPKRDLIAVFRITPADGFTIEAAAGAVAAESSTGTWTSLYPW
YEQERWEDMSAKAYHFHDMGDGSWVVRIAYPVHLFEEGNMPGMLASVAGNVFGMKRVKGL
RLEDIYLPERFLREFSGPAHGIEGVRKIFGIKDRPIVGTVPKPKVGYSPEELEKLAYDLL
SGGMDYIKDDENLTSPWYNRFEDRAEVLMKVIEKVENETGEKKSWFANITADIREMERRL
EILADYGNPHAMVDVVVTGWGALEYIRDLAEDYGIALHAHRAMHATFTRNPYHGISMFVL
AKLYRVIGLDQLHVGTAGAGKLEGKKWEVIQFARIFKEKHYVPEENDVFHLEQKFYHIKP
AMPVSSGGLHPGNLEPVIDALGTELVLQIGGGTLGHPDGPKAGAMAVRQALDAIIQGIPL
DEYAKTHKELARALEKWGHVTPV
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagaagtttgagatatatgaccaatatgtagataaggaatatgaaccaaatccc
aagagggatttgatagcggtttttagaataacccccgcagatggttttacaattgaggct
gctgctggagcagttgctgctgagagttctacaggaacatggactagcctgtatccatgg
tatgagcaagaaagatgggaggacatgtctgctaaagcctatcacttccacgatatggga
gatgggagttgggttgtgagaatagcatatccagttcacctcttcgaagaagggaacatg
cctggaatgctagcttcagttgctggaaacgtctttggaatgaagcgtgttaaggggtta
agacttgaggatatttatttaccagaaagatttctgagagagttcagtggtccagctcat
ggtattgaaggtgttagaaagatatttggcatcaaagatagacccattgtgggaactgtg
cccaagccaaaggttggttattctcccgaagaacttgaaaaactcgcttatgacctactc
agcggcggaatggactacatcaaggacgatgaaaacttgaccagcccatggtacaaccgc
tttgaggacagagcggaggttcttatgaaagttattgagaaagtcgagaacgagactggc
gagaagaagtcatggttcgccaacataacggccgacataagggagatggagagaaggctt
gaaatcttagcagattatggaaatccacatgcaatggttgatgtggttgttacaggttgg
ggagctttggaatacattagagacttagctgaagattacggcatcgctctgcacgcccac
agagcaatgcatgcaacattcacaagaaatccctatcatggtatttcaatgttcgtctta
gccaagctctatagagtcataggtctcgaccagctccacgttggaacagctggagcagga
aagcttgaaggcaagaagtgggaagttatacaatttgcaaggatctttaaagagaaacac
tatgttccagaagagaatgatgtcttccatctcgagcagaagttctatcacataaagcca
gcaatgcctgttagctctggtgggcttcacccaggtaaccttgagccagtcatagatgct
ctcggcaccgagcttgttcttcaaatcggtggtggaacccttggacaccccgatggacca
aaagctggagcgatggctgtgagacaggctttagatgccataatacagggaatacctctc
gatgaatacgcaaagacccacaaggaacttgcaagagctttagagaagtggggtcatgta
accccagtttga

DBGET integrated database retrieval system