KEGG   Thermococcus paralvinellae: TES1_1351Help
Entry
TES1_1351         CDS       T03005                                 

Definition
(GenBank) tungsten-containing aldehyde:ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
ths  Thermococcus paralvinellae
Pathway
ths00030  Pentose phosphate pathway
ths01100  Metabolic pathways
ths01120  Microbial metabolism in diverse environments
ths01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ths00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TES1_1351
Enzymes [BR:ths01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     TES1_1351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: AHF80729
UniProt: W0I3V9
LinkDB All DBs
Position
1279820..1281637
Genome map
AA seq 605 aa AA seqDB search
MFGYHGKILRVNLTTGKISEEKFDEKFAQKWLGTRGFGVYFLLKEMDPTVDPFSPENKLI
FATGPLTGTTAPTGGRYMVITKSPLTGYIAMANSGGFFGAELKFAGWDAIIFEGKADHPV
YLYINDDQVELRDASHVWGKVVSETEKILTEEVGDKRVQIASIGPAGENLVRFAAVMNNG
HRAAGRGGVGAVMGSKNLKAIVVRGHKRVEIADRQKFTSVVKEKIEKLKKDPVAGGGLPT
YGTAVLVNIINSNGLYPTRNFQDSQFEYAEEQSGEAMRAKYLVRNKPCFACPIGCGRVNV
LPTLGETEGPEYESIWALGAHLGINDLASIIEANHLCDEYGLDTISTGGTLATAMELYER
GLIKPEDIGDAPPLRFGNTEVLHYYIEKLTFRKGFGDILAEGGYRVAEKFNGVEYFMGVK
KQELPAYDPRGAEGHGLGYATNNRGGCHIKQYMISPEILGYPYKMDPHDISDEKVKMVIL
FQDLTALIDAAGLCLFTTFGLGADDYRDMLNAALGWDFTTEEYLKIGERIWNAERLFNLK
AGLDPLKEDTLPKRLLEEPVKQGPNKGHVVRLKEMLPRYYALRGWTEDGKVPEEKIKELG
LEEVA
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgttcggataccatggtaaaattttgagggtaaacttgacaacaggaaagattagtgaa
gagaagttcgatgagaaatttgcccaaaaatggcttggaactagaggttttggtgtctat
ttcctactgaaggagatggacccaacagttgacccatttagcccagagaacaagttgatt
tttgcaacaggtccactgacaggaacaactgccccaacaggcggtagatacatggttatt
acaaaaagcccgcttactggctatatagccatggcaaactctggtggattcttcggtgca
gagcttaaatttgctggatgggatgccataatcttcgaaggcaaagcagatcaccctgtg
tacctctacataaacgatgaccaagttgagctgagagatgcctcacacgtatggggtaaa
gtcgtcagtgaaactgaaaagatcctcacagaagaagttggcgacaagagggtacagatt
gcatcaattggaccagctggtgaaaacttagttagattcgcagctgtgatgaacaacgga
cacagagcagcaggtagaggcggtgtcggtgctgtaatgggttcaaagaaccttaaggcc
atagtcgttagaggccacaagagagttgagattgctgacaggcagaagttcacaagtgtt
gtcaaggagaagattgagaagctcaagaaagacccggttgccggtggaggactgccaaca
tatggaacagctgttctggttaacatcatcaattcaaatggtctctatccaacaagaaac
ttccaagatagccagttcgagtatgctgaggaacaaagcggtgaggccatgagagcaaag
tacttggtcagaaacaagccatgttttgcatgtccaattggatgtggaagagttaacgtt
ctaccaaccctcggagagactgaaggaccagagtatgaaagcatctgggctctcggtgca
caccttggcataaatgaccttgcaagcatcattgaagcaaatcacctctgtgatgagtac
ggactggatacaatctcaacaggtggtactttagcaacggcaatggagctctatgagaga
ggtctcataaagcccgaggacataggagatgcaccaccactcaggtttggaaatacagag
gttctccactactacattgaaaagcttacatttagaaaaggctttggagacatcctagct
gaaggcggttacagagttgctgagaaattcaacggcgttgagtacttcatgggtgttaag
aagcaagagctaccagcttacgatccaagaggtgccgaaggtcacgggcttggttatgca
accaacaacagaggaggatgtcacatcaaacagtacatgatcagcccagaaatattggga
tacccatacaagatggatccacacgacataagcgacgagaaagtgaaaatggtcatacta
ttccaagacttgacagcattaattgatgcagcaggactatgtctcttcacaacattcgga
cttggcgcagatgattacagggacatgcttaacgccgctcttggctgggacttcacaact
gaggaatacctcaagatcggtgagagaatctggaacgcagagagactcttcaacctcaaa
gcagggcttgatccactcaaggaagacacattgccgaagagactccttgaggagcctgtt
aaacagggaccaaacaagggacatgtcgttagactcaaggaaatgcttccgagatattat
gcacttagaggatggacagaagacggtaaggttccagaggagaaaattaaagagcttgga
cttgaagaggttgcctga

DBGET integrated database retrieval system