KEGG   Thermococcus paralvinellae: TES1_1749Help
Entry
TES1_1749         CDS       T03005                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ths  Thermococcus paralvinellae
Pathway
ths00620  Pyruvate metabolism
ths00680  Methane metabolism
ths00720  Carbon fixation pathways in prokaryotes
ths01100  Metabolic pathways
ths01120  Microbial metabolism in diverse environments
ths01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ths00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TES1_1749
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TES1_1749
   00680 Methane metabolism
    TES1_1749
Enzymes [BR:ths01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     TES1_1749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2 HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: AHF81124
UniProt: W0I4Y2
LinkDB All DBs
Position
complement(1667073..1668503)
Genome map
AA seq 476 aa AA seqDB search
MIPRTMSTQHPDNVYIPFFAQEPQLSGEDEIIEAFYAFSVLGIEEQMWDFEGKEVDEFVV
KKLLERYPHFFRKHKLGRDFRLTPRVPNPSVEKAEAKLLLETLESIPRSADYSKIFYEEE
TAPIFEVILPMTTSANEINRVYELYKRYIVGKQYKRIYDIKLYEWIGEFFPGEINVIPLF
ETKEAILNSAEILREYLYGKDFEYQRVFLARSDPAMNYGLLSAVIYDKYALFKLQKLEDE
ESVDIYPIIGVGSAPFRGHLVPENVDNVLEEYRGAQTFTIQSSFKYDNPPKEVIKAVEKI
KSSKRKEAEPIDEQILSILRKYEIEYSKQIKALAMLIREVAKFVPSRRKRKLHIGLFGYA
RDVNGFALPRAIKFTASLYSLGIPPEVLGLNALSEKDIEVVGEVYKGIYKDLSFAFSYFN
PKSAEKFKFLRDILKMSQLFEFERNEEHCEITSKILHGEINEELIIKAASIRGFLG
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgataccaagaactatgagcactcaacatcctgacaatgtgtatatacctttctttgct
caggagcctcaattaagtggtgaggatgaaataattgaagcgttttatgctttcagtgtt
ctaggaatagaagaacaaatgtgggacttcgaaggaaaagaggttgacgagtttgttgtt
aaaaagcttctggagagataccctcacttcttccgaaagcacaagcttggaagggatttt
aggttaactccaagagtcccaaatccaagtgttgagaaagccgaagcaaagcttttgctt
gaaacactcgaaagtattccccgttcagctgattattcgaagatattttacgaagaggag
actgctccgatatttgaagttatccttccaatgacaacttcagcaaacgaaattaacaga
gtctacgagctgtacaaacgttatattgttggaaagcagtacaagaggatctacgacata
aagctctacgagtggattggggaattctttcctggggagattaatgtaatacctctcttt
gaaacaaaagaggcaatactaaactcagctgaaatattgagagagtacttgtatgggaag
gactttgaataccagcgtgttttcctggcaagaagtgatcctgccatgaactatggcctg
ttaagcgccgttatctatgataaatatgctctctttaagcttcagaagcttgaagatgag
gagagtgttgatatttatccgataattggtgttggcagtgcgccttttagaggtcatctt
gtccctgaaaatgttgacaatgttctggaagagtatagaggggctcagacgtttacaatt
caaagttcatttaagtatgataatccaccaaaggaagtcataaaagccgttgagaaaatt
aaaagctcaaagagaaaagaagctgagccaattgatgagcaaatcctctcaattctccga
aaatatgaaattgaatattccaagcagattaaagctttggcaatgttgataagagaggtt
gctaagtttgttccctctaggagaaagagaaagctccacattggactatttggttatgct
agggacgttaatggttttgcacttccaagagcaataaagttcactgcatctctttattcc
cttggcatacctccagaggttcttggattaaatgcacttagcgaaaaggacattgaagtt
gtgggagaagtttacaagggcatttacaaagatttaagcttcgcattcagttatttcaac
cctaaatcagctgagaaatttaaattcctaagggacattctgaaaatgagccaattgttt
gaatttgagagaaatgaggaacactgtgaaattacaagcaaaatcttgcatggtgagatt
aatgaagagttaataatcaaagcagcgagcattaggggattcttggggtga

DBGET integrated database retrieval system