KEGG   Thalassotalea sp. HSM 43: E2K93_06390Help
Entry
E2K93_06390       CDS       T05926                                 

Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
tht  Thalassotalea sp. HSM 43
Pathway
tht00260  Glycine, serine and threonine metabolism
tht01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tht00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    E2K93_06390
Enzymes [BR:tht01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     E2K93_06390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C FAD_binding_3 HI0933_like Methyltransf_25 Pyr_redox_3 Pyr_redox_2 TrkA_N UDPG_MGDP_dh_N FAD_oxidored Pyr_redox 2-Hacid_dh_C MTS
Motif
Other DBs
NCBI-ProteinID: QBY04033
LinkDB All DBs
Position
1497751..1498776
Genome map
AA seq 341 aa AA seqDB search
MKSLAKLKPETGIWMTDSPMPEVGPNDLLIKIKKTAICGTDIHIYNWDEWSQKTVPVPMV
VGHEYAGVVIGMGSEVKGFAEGDRVSGEGHITCGHCRNCRAGRTHLCNNTIGVGVDRTGC
FAEYLVIPAFNAFKLPDEVPDELASIFDPFGNAVHTALSFDLVGEDVLITGAGPIGIMAA
AVAKHVGARHVVITDINEYRLDLARKMGATRAVNVANENLPDVMKELGMTEGFDVALEMS
GVPSAFHAMLDSMNNGGKIAMLGIPGQDMAIDWAKVIFKGLVIKGIYGREMFETWYKMAS
LIQSGLDISPIITHEFGIDEFQQGFDAMLSGNSGKVILNWD
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctttagcaaaattaaaaccagaaaccggcatttggatgacagactcaccaatg
ccagaagtaggtccaaatgatctactgattaaaattaagaaaaccgctatttgtggtact
gacattcacatttacaactgggatgaatggtcacaaaagaccgttccagtgcctatggtt
gttggtcatgaatacgccggtgtcgtgattggtatgggcagtgaagtaaaaggctttgct
gaaggtgatcgcgtttctggcgaaggtcatattacctgtgggcattgtcgtaactgtcgt
gctggtcgtacccacttatgtaacaacaccataggtgttggtgtcgatcgcaccggttgt
tttgccgagtacttggtgattccagcctttaatgcctttaaattaccggacgaagtgcca
gatgaattggcgtcaatttttgacccatttggtaacgccgtacatactgcgttgtcattt
gatttggtcggcgaagatgtgttgatcacaggcgcaggcccaatcggtattatggcagca
gcggttgccaaacacgttggtgcacgccatgtcgtgatcaccgacatcaatgaataccgt
ctagatttggcccgtaaaatgggcgcaacacgcgccgtaaatgttgccaatgaaaacttg
ccagatgttatgaaagaactcggcatgaccgaaggctttgatgttgcattagaaatgtct
ggtgtgccatcagcatttcacgccatgctcgatagcatgaacaatggcggtaagattgcc
atgctcggtattccgggtcaggatatggctatcgactgggcgaaagtgatattcaaaggt
ttggttatcaaaggcatttacggtcgtgaaatgtttgaaacctggtacaaaatggcgagc
ttgatccaatctggtttggacatcagccctatcattacccacgagtttggcattgacgaa
ttccagcaaggctttgatgccatgctgtcgggtaattccggtaaggttattcttaactgg
gattaa

DBGET integrated database retrieval system