KEGG   Thalassotalea sp. HSM 43: E2K93_12860Help
Entry
E2K93_12860       CDS       T05926                                 

Gene name
fabB
Definition
(GenBank) beta-ketoacyl-ACP synthase I
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Organism
tht  Thalassotalea sp. HSM 43
Pathway
tht00061  Fatty acid biosynthesis
tht00780  Biotin metabolism
tht01100  Metabolic pathways
tht01212  Fatty acid metabolism
Module
tht_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:tht00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    E2K93_12860 (fabB)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    E2K93_12860 (fabB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:tht01004]
    E2K93_12860 (fabB)
Enzymes [BR:tht01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.41  beta-ketoacyl-[acyl-carrier-protein] synthase I
     E2K93_12860 (fabB)
Lipid biosynthesis proteins [BR:tht01004]
 Fatty acid synthase
  Component type
   E2K93_12860 (fabB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N KAsynt_C_assoc
Motif
Other DBs
NCBI-ProteinID: QBY05215
LinkDB All DBs
Position
2959091..2960302
Genome map
AA seq 403 aa AA seqDB search
MKRVVITGLGIVSSIGNNAEEVLASLKEGRSGISRSESFAEYGLRSQVWGKPNIEPKEHI
DRKVFRFMGDAAGYSYIAMEEAIKDAKLTDDQVSNYRTGLIAGSGGASSLNVVNSADTLR
NKGVKRVGPYAVPKTMSSTCSACLATPFKILGNNYSISSACATSAHCIGHAAELIQLGKQ
DIVFAGGGEEVDWSLAMMFDGMGALSTKYNDNPENASRTYDANRDGFVISGGGGMVVVEE
LEHALARGAHIYAEIVGYGATSDGYDMVAPSGEGAVRCMQQAMEGVDGKIDYLNTHGTST
PVGDVKELGAIQEVFGHDSPAISATKAMTGHALGAAGVHEAIYTMLMMEHNFIAPSVNVE
ELDEKAEGLNIVTATQDAEINLAMSNSFGFGGTNSTLVLQKYK
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtgtcgtaattacaggtttaggtattgtttctagtattggtaacaacgccgaa
gaagtactggcttcacttaaagaaggtcgttcaggtatctctcgttcagagagcttcgct
gagtatggtttgcgttctcaagtttggggtaaaccaaacatcgagccaaaagagcatatc
gatcgtaaagttttccgctttatgggtgatgcagcaggctattcatatattgctatggaa
gaagcaattaaagacgcaaaattaacggacgatcaagtatctaactatcgtacaggtctt
attgctggttctggtggtgcatcgtcattgaatgttgttaattcagctgacaccttgcgc
aacaaaggcgtaaagcgcgttggtccttatgccgtgcctaagacaatgtcttcaacatgt
tctgcatgtttggcgacaccgttcaagattctaggtaataactactctatcagctctgca
tgtgcgacatcagcacactgtattggtcacgctgctgaattgatccaattaggtaagcaa
gatatcgttttcgccggtggtggtgaagaagtagattggtcattggctatgatgtttgat
ggcatgggcgcattatcgactaagtataatgacaaccctgaaaatgcctcacgtacctat
gatgcaaaccgtgacggtttcgttatctctggcggtggcggtatggttgtcgttgaagaa
cttgagcatgcattggctcgtggcgcacatatctatgctgaaatcgttggctacggtgcg
acctctgacggttacgacatggttgccccaagtggtgaaggcgctgttcgttgtatgcaa
caagcgatggaaggtgttgacggtaagattgattacttaaacacacacggtacatcgact
ccagttggtgacgttaaagagcttggcgctattcaagaagtattcggtcatgactctcca
gctatctctgcaacgaaagcgatgactggtcacgctttaggcgctgcaggtgttcatgaa
gcgatttatactatgctgatgatggagcacaacttcatcgcgccatcagtaaacgttgaa
gaattggatgagaaagctgaaggcttaaacatcgtaactgcaacgcaagacgctgaaatc
aacttagcaatgtctaacagctttggttttggtggtactaactcaacacttgtattgcaa
aaatataagtaa

DBGET integrated database retrieval system