KEGG   Thauera humireducens: AC731_001615Help
Entry
AC731_001615      CDS       T04211                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
thu  Thauera humireducens
Pathway
thu00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:thu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AC731_001615
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:thu02000]
    AC731_001615
Enzymes [BR:thu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AC731_001615
Transporters [BR:thu02000]
 Other Transporters
  Pores ion channels [TC:1]
   AC731_001615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_C GST_N_3 GST_C_3 GST_N_2 GST_C_2 GST_C_6 2Fe-2S_Ferredox
Motif
Other DBs
NCBI-ProteinID: AMO35756
UniProt: A0A140IDD1
LinkDB All DBs
Position
342144..342749
Genome map
AA seq 201 aa AA seqDB search
MKLYYKPGACSLSPHIVLEECGLPYETEAVDLKTKVTAGGADFTRINPKGYVPALLLDGG
ELLTEGPAIVQYLADRVPEKRLAPPNGTVERYRLQSWLTFIGTELHRSCSPFFNPASGDT
WKAAAMANLERRLDYTNGELAGKAYLLGDDFSVADAYLFTVLSWMPFVKIDLSRWSNLTA
FQARVAARPAVQAALKAEGLA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctactacaagcccggcgcctgctcgctgtcaccccacatcgtgctcgaagag
tgcggcctgccgtacgagaccgaagcggtcgatctgaagaccaaggtgacggccggcggc
gccgacttcacgcggatcaaccccaagggctatgtgccggcgctgctgctcgacggcggc
gaactgctgaccgaagggccggcgatcgtgcagtaccttgcggaccgcgtgccggagaag
aggctcgcgccgccgaacggcacggtcgagcgctaccgcctgcagtcgtggctgaccttc
atcggcaccgaactgcatcgatcgtgctcccccttcttcaaccccgcttcgggtgacacc
tggaaggcggcggcgatggccaatctcgaacgccggctcgattacacgaacggcgaactg
gccggcaaggcgtatctgctgggcgacgatttcagcgtggccgacgcttacctgttcacc
gtgctgagctggatgcccttcgtcaaaatcgacctgtcgcgctggtccaacctgactgcc
ttccaggcgcgcgttgccgcccgcccggcggtgcaggccgcactcaaggccgaagggctc
gcctga

DBGET integrated database retrieval system