KEGG   Thauera humireducens: AC731_003305Help
Entry
AC731_003305      CDS       T04211                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
thu  Thauera humireducens
Pathway
thu00020  Citrate cycle (TCA cycle)
thu00190  Oxidative phosphorylation
thu00650  Butanoate metabolism
thu01100  Metabolic pathways
thu01110  Biosynthesis of secondary metabolites
thu01120  Microbial metabolism in diverse environments
thu01130  Biosynthesis of antibiotics
thu01200  Carbon metabolism
Module
thu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
thu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
thu_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:thu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AC731_003305
   00650 Butanoate metabolism
    AC731_003305
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AC731_003305
Enzymes [BR:thu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AC731_003305
    1.3.5.4  fumarate reductase (quinol)
     AC731_003305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO Thi4 FAD_binding_3 GIDA HI0933_like Pyr_redox_3 Lycopene_cycl NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AMO36049
UniProt: A0A140IE74
LinkDB All DBs
Position
695853..697646
Genome map
AA seq 597 aa AA seqDB search
MNVAKRTFDAVIVGAGGAGLRAALQLSESGLKTAVLTKVFPTRSHTVAAQGGVAASLGNS
TEDNWHWHMYDTVKGSDWLGDQDAIEFMCKKANEVVVELEHYGMPFDRTDNGKIYQRPFG
GHSMNYGQAPVMRSCAAADRTGHAMLHALYQRNVRANTQFFVEWMALDLIRNADGDVLGV
TAMEMETGEVSIFHAKATIFATGGAGRIYYSSTNAFINTGDGVGMAARAGIPLEDMEFWQ
FHPTGVAGAGVLITEGVRGEGGILRNASGERFMERYAPNLKDLASRDVVSRAMTTEINEG
RGAGPDKDHVLLDITHLSPDTIMKRLPGIREIAIQFAGVDPIKAPIPVVPTCHYQMGGIP
TNYKGQVVVPKDGNPNTPVQGFYAAGECACASVHGANRLGTNSLLDLLVFGKSAGETVVE
DFKSGQLTLKPLPENAADVSLARLARLESQTNGESVFDVGMEMRRTMQKHAGVFRFDQLL
KEGVQKIGEVAERAKRTEIKDKSKVWNVARMEALELDNLIEVARATMVSAEARKESRGAH
VRDDAPDTPENPNGRDDANWLKHTLWYSEGNRLDYKPVNLKPLSDDVEPIALAKRTY
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgtcgcaaagcgtacctttgatgcggtcatcgtcggcgcgggtggtgctggcctg
cgtgcggccctgcaactgtccgaatccggtctcaagaccgcagtgctgaccaaggtcttc
ccgacgcgttcgcataccgtcgcagcccagggcggcgtcgccgcctcgctcggcaactcg
accgaggataactggcactggcacatgtacgacaccgtgaagggttcggactggctgggt
gaccaggatgccatcgagttcatgtgcaagaaggcgaacgaagtcgtcgtcgagctggaa
cactacggcatgcctttcgatcgcaccgacaatggcaagatctatcagcgcccgttcggt
ggtcactcgatgaactacggccaggcgccggtgatgcgctcctgtgcggctgccgaccgt
accggtcacgccatgctgcatgcgctctaccagcgcaacgttcgcgcgaacacgcagttc
ttcgtcgaatggatggcgctggacctgatccgcaacgccgatggcgatgtgctcggcgtg
accgcgatggagatggagaccggcgaggtctcgatcttccacgccaaggccaccatcttc
gcgaccggcggcgccggccgtatctactactcctcgaccaacgccttcatcaacaccggt
gacggcgtgggcatggcggcgcgtgccggcattccgctggaagacatggagttctggcag
ttccacccgactggcgtggccggtgcgggcgtactgatcaccgaaggtgtccgtggcgaa
ggcggcatcctgcgcaacgcctcgggcgagcgtttcatggagcgctacgcgcccaacctg
aaggatctggcctcgcgcgacgtcgtctcgcgcgcgatgaccaccgagatcaatgagggt
cgcggtgccggtccggacaaggatcacgttctgctggacatcacccacctgtcgcccgac
acgatcatgaagcgcctgccgggcattcgcgagatcgcgatccagttcgccggcgtcgat
ccgatcaaggcgccaatcccggtcgtgccgacctgccactaccagatgggcggtattccg
accaactacaagggccaggtcgtggtgccgaaggacggcaatccgaacacgccggtccag
ggtttctacgccgctggcgaatgcgcctgcgcctcggtccacggcgcgaaccgcctcggc
acgaactcgctgctcgacctgctggtgttcggcaagtcggcgggtgagaccgtggtcgag
gacttcaagtcgggtcagctgaccctcaagccgctgcccgagaacgcggccgatgtctcc
ctggctcgcctcgcgcgcctggagtcgcagaccaacggcgagagcgtgttcgacgtcggc
atggaaatgcgccgcacgatgcagaagcacgccggcgtgttccgtttcgaccagctgttg
aaggaaggcgtgcagaagatcggcgaggtggccgagcgtgccaagcgcaccgagatcaag
gacaagtccaaggtctggaacgtggcccgcatggaagcgctggaactggacaacctgatt
gaagtcgctcgcgccacgatggtgtcggccgaggcccgcaaggagtcgcgtggtgctcac
gtgcgcgacgacgcgccggatacgccggagaatccgaacggtcgcgatgacgccaactgg
ctcaagcacaccctgtggtacagcgaaggcaaccgtctggattacaagccggtcaacctg
aagccactgtccgacgacgtcgagccgatcgcgctcgccaagcgcacttattga

DBGET integrated database retrieval system