KEGG   Thauera humireducens: AC731_003310Help
Entry
AC731_003310      CDS       T04211                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
thu  Thauera humireducens
Pathway
thu00020  Citrate cycle (TCA cycle)
thu00190  Oxidative phosphorylation
thu00650  Butanoate metabolism
thu01100  Metabolic pathways
thu01110  Biosynthesis of secondary metabolites
thu01120  Microbial metabolism in diverse environments
thu01130  Biosynthesis of antibiotics
thu01200  Carbon metabolism
Module
thu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
thu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
thu_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:thu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AC731_003310 (sdhB)
   00650 Butanoate metabolism
    AC731_003310 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AC731_003310 (sdhB)
Enzymes [BR:thu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AC731_003310 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     AC731_003310 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4
Motif
Other DBs
NCBI-ProteinID: AMO36050
UniProt: A0A140IE75
LinkDB All DBs
Position
697678..698388
Genome map
AA seq 236 aa AA seqDB search
MTKRTVQFKIYRYDPDKDEKPYMQDISVELEASDKKLLDAIVRLRAKDDSLSFRRSCREG
VCGSDAMNINGKNGLACLTDIDSLQQPITLRPLPGLPVIRDLIVDMTQFFKQYHSIKPYL
VNNDPTPERERLQSPEDREELNGLYECILCACCSTSCPSFWWNPDKFVGPAGLLAAYRFL
ADTRDQDTNARLDNLEDPYRLFRCHSIMNCVDVCPKGLNPTRAIGKIKDMMVRRAV
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagcgtaccgttcaattcaagatctaccgctacgatccggacaaggacgagaag
ccctacatgcaggacatctcggtcgagctcgaggcctccgacaagaagctgctcgatgcg
atcgtccgcctgcgcgcaaaggacgattcgctgtccttccgtcgctcatgccgcgaaggc
gtgtgcggttcggacgcgatgaacatcaatggcaagaacgggctggcctgcctgaccgac
atcgacagcctgcagcagccgatcacgctgcgtccgctgccgggtctgccggtcatccgc
gacctgatcgtcgacatgacgcagttcttcaagcagtaccactcgatcaagccctatctg
gtcaacaacgacccgacccccgagcgcgagcgcctgcagtcgccggaagaccgcgaggag
ttgaacggcctgtacgagtgcatcctgtgcgcgtgctgctcgacgtcctgcccgtcgttc
tggtggaacccggacaagttcgtcggcccggccggtctgcttgccgcataccgcttcctc
gccgacacgcgcgaccaggacacgaacgcgcgcctcgacaacctcgaggacccgtaccgt
ctgttccgttgccattccatcatgaactgcgtcgacgtctgtccgaagggtctgaacccg
acccgcgcgatcggcaagatcaaggacatgatggttcggcgtgcggtataa

DBGET integrated database retrieval system